(data stored in ACNUC7421 zone)

EMBL: CP001622.PE246

CP001622.PE246       Location/Qualifiers
FT   CDS_pept        complement(258973..259407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0247"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: rec:RHECIAT_CH0000634 probable
FT                   transcriptional regulator protein, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54558"
FT                   /db_xref="GOA:C6B0D9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0D9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS54558.1"
FT                   /translation="MEGDAFSAFAITALRLAGHLTAAGDQLAKPAGQTSARWQVLAAAR
FT                   RGGMSVAQIARALGVARQGVQRLADVLENEGLIAYADNPQHQRAKLVRLTEEGAARLGV
FT                   IEIAQAGWADGLGAAFTSAELDAARVVMARVMEMLEGGEA"
     atggaggggg atgccttttc cgcttttgcg atcaccgccc ttcgcctcgc cggccatctg        60
     acggcggcgg gcgaccagtt ggcaaagccg gcaggacaaa ccagcgcgcg ctggcaagtg       120
     ctggcggcgg cacgacgcgg cggcatgtcg gtggcgcaga tcgcccgtgc gctcggcgtc       180
     gcccgccagg gcgtgcagcg gcttgccgat gtgctggaga atgaagggct gatcgcctat       240
     gccgacaacc cgcagcacca gcgcgccaag ctggtacgat tgacggaaga aggggcggcg       300
     cggctcggcg tcatcgagat cgcgcaagcc ggatgggccg acgggctggg cgctgctttc       360
     acgtcagcgg aactcgatgc ggcacgggtg gtgatggcgc gggttatgga gatgctggaa       420
     ggtggcgagg cgtaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page