(data stored in ACNUC7421 zone)

EMBL: CP001622.PE247

CP001622.PE247       Location/Qualifiers
FT   CDS_pept        259523..259927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0248"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: ret:RHE_CH00562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54559"
FT                   /db_xref="GOA:C6B0E0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E0"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACS54559.1"
FT                   /translation="MKKTYRGSCHCGKVHYQVDMDLEEGTGRCNCSICAKRRYWGANVK
FT                   PEDFRLMCDQAETSDYQFNTMSGHHRFCRTCGVPAYGDGYVEQIGGAYVSINIACLDDI
FT                   TPEELAALPVRYADGRHDAWWNEPAVTSYL"
     atgaagaaaa cctacagagg aagctgccat tgcggcaaag tgcactacca ggtggacatg        60
     gacctcgagg agggcaccgg ccgctgcaat tgttcgatct gcgccaagcg gcgctattgg       120
     ggcgccaacg tcaagccgga ggatttccgg ctgatgtgcg accaggcgga aacgtccgac       180
     tatcagttca acaccatgag cggtcatcac cgcttctgcc gcacctgcgg tgtgccggcc       240
     tatggcgacg gttatgtcga acaaatcggc ggcgcctatg tctcgatcaa catcgcctgc       300
     cttgacgata tcacccctga ggaactggca gcactgcctg tccgttatgc cgatggcagg       360
     cacgatgcct ggtggaacga accggcggtg acgagttatc tctga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page