(data stored in ACNUC7421 zone)

EMBL: CP001622.PE248

CP001622.PE248       Location/Qualifiers
FT   CDS_pept        260021..260464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54560"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000636"
FT                   /protein_id="ACS54560.1"
FT                   /translation="MKDEANARIEEEAIIAMLMMRAKALGEKNASDALSYEAEDSVEFS
FT                   LAPPLVYHGQDEAGLQAWFDTWEGPIGGEVRDARLTVGEDVAFWSGLTRMSGTKTDGTA
FT                   VDLWFRQTLGLVKQDGRWLVAHQHASVPFAMDGSGRALLDLKP"
     gtgaaagacg aagcgaatgc caggatcgag gaagaggcga tcatcgccat gctgatgatg        60
     cgcgccaagg cgctgggtga gaagaacgcc agcgacgcgc tttcctatga ggccgaggat       120
     tccgtcgaat tttcgctggc gccgccgctc gtctaccacg gccaggacga agcgggtctg       180
     caggcctggt tcgatacctg ggaaggcccg atcggcggcg aggtgcgcga tgccagactg       240
     accgttggcg aggatgtcgc tttctggagc ggcctcacgc gcatgagcgg gaccaagacc       300
     gacggcaccg ccgtcgatct ctggttccgc cagaccctcg gtctcgtcaa gcaggatggc       360
     cgctggctgg ttgcccacca gcacgcctcg gtgcccttcg ccatggacgg cagcggccgg       420
     gcactgctcg atctcaagcc gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page