(data stored in ACNUC7421 zone)

EMBL: CP001622.PE249

CP001622.PE249       Location/Qualifiers
FT   CDS_pept        complement(260474..261676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0250"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rec:RHECIAT_CH0000637 probable transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54561"
FT                   /db_xref="GOA:C6B0E2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS54561.1"
FT                   /translation="MFAAAKSTENSPRPSIGFHALTLATFFGASAAPTPLYRIYQESFS
FT                   VSPVLITVIFAVYAFALLAALLIAGSISDHLGRKPVIFFALVLEIAAMGLFVVASGPAW
FT                   LIAARIVQGLATGIAGASIGAALVDVDRAKGQIVNSIAPLCGMAVGAVGTSALIQYGPF
FT                   PMHLVYALLLVAFTLQAAAIWLTGETGGTRPGALGSLIPRVTIPQQVKRPLSLVTPINI
FT                   ANWTLAGFYLSLVPSLVASTTGSRAPLTGGAVVTALMVSGAIAVYLRRSKTASANLVFG
FT                   VSAKTLGILTVVAGVHLANVPLLLVGTIFTGVGFGTNFLGSIGTIMPLAKPDERAGLLS
FT                   AFYVQSYLAFSLPAILAGFLAKSAGYALTTDIYATAILLLMGVGMVSIRADRRRVAESA
FT                   A"
     atgttcgccg cagccaaatc caccgagaat tcgccgcgtc cctcgatcgg ctttcatgcg        60
     ctgacgctcg ccaccttctt cggcgcctcc gcggcgccga cgccgctcta ccggatctat       120
     caggaaagtt tttccgtctc gccggtgctg atcacggtga tcttcgcggt ctacgccttc       180
     gcgctgctgg cggcgctgct gatcgccggt tcgatctcgg atcatctcgg ccgcaagccg       240
     gtgatctttt tcgccctcgt gctcgaaatc gccgcgatgg gcctcttcgt cgtcgcgagc       300
     ggtcccgcct ggctgatcgc ggcgcggatc gtgcaggggc tggcaacggg gatcgccggc       360
     gcctcgatcg gagcggcgct cgtcgatgtc gaccgggcaa agggacagat cgtcaattcg       420
     atcgcgccgc tttgcggcat ggcagtgggg gcagtgggca ccagcgccct gatccaatac       480
     gggcccttcc cgatgcatct ggtctatgcg ctgctgctcg tcgccttcac gctgcaggcg       540
     gctgccatct ggctgacagg cgagaccggc ggcacgcggc cgggggctct cggctcgctg       600
     ataccgcggg tcaccattcc ccagcaggtg aagcggccgc tctcactggt gacgccgatc       660
     aacattgcca attggacgct tgccggcttc tatctctcgc tggtcccgtc cttggtcgcc       720
     agcacgaccg gcagccgggc gccgctgacg ggcggggccg tcgtcaccgc gctgatggtg       780
     agcggagcaa tcgccgtcta tctcaggcgc agcaagacgg catcggccaa tctggttttt       840
     ggcgtgtcgg ccaagacgct cggcatcctg accgtcgttg ccggcgtgca tcttgccaat       900
     gtgccgctgc tgctcgtcgg cacgattttc accggcgtcg gtttcggcac caatttcctc       960
     ggttcgatcg gcaccatcat gccgcttgct aaaccggacg agcgggccgg gctgctatcg      1020
     gccttctacg tccagagcta cctcgccttc agcctgccgg cgatcctagc cgggttcctc      1080
     gcgaaatcgg ccggctacgc attgacgacg gatatctatg cgacggcgat cctgcttttg      1140
     atgggcgtcg gaatggtgag cattcgcgcc gaccggcgca gggtggcgga gagcgcggcc      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page