(data stored in ACNUC7421 zone)

EMBL: CP001622.PE25

CP001622.PE25        Location/Qualifiers
FT   CDS_pept        24569..25030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0025"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bph:Bphy_6989 alkylhydroperoxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54337"
FT                   /db_xref="GOA:C6AYB3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB3"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACS54337.1"
FT                   /translation="MDFFMADRIDCASASPDGFNAFAGVRAAVEKSDLPKQLFDLVYLR
FT                   VSQMNRSALYVDVHSRSLLELGLTVEKLGQVPIWRNAGHLFNARERSALAWAETVTRVA
FT                   ETGVPDSDYEAAAVEFNNKELADLTYAIALMNALNRIGMAFRSTLSGKA"
     atggatttct tcatggcgga tcgcattgat tgtgccagtg cttcccctga cggtttcaac        60
     gccttcgcgg gcgttcgcgc cgctgttgag aagagcgacc ttcccaagca actgttcgat       120
     ctggtttatc tacgagtttc gcaaatgaat cgcagtgcgc tttacgtcga cgtacattcc       180
     cgcagtctct tggagttagg gctgaccgtt gagaagctcg ggcaagtgcc catatggcga       240
     aacgctggtc acctattcaa cgcccgcgaa cgaagcgcgc tggcgtgggc ggaaaccgta       300
     acacgtgtcg ccgaaaccgg cgttcctgat agcgattatg aggctgctgc tgtcgaattc       360
     aacaacaagg aactagcgga cctgacatat gcgattgccc tgatgaacgc tctgaatcga       420
     atcgggatgg cgttccgctc aacgctctct ggaaaagctt ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page