(data stored in ACNUC7421 zone)

EMBL: CP001622.PE250

CP001622.PE250       Location/Qualifiers
FT   CDS_pept        261814..262371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0251"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   rec:RHECIAT_CH0000638 probable transcriptional regulator
FT                   protein, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54562"
FT                   /db_xref="GOA:C6B0E3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54562.1"
FT                   /translation="MTVKENLRPGGRSARVQASVHKAVRELMAEMSRAEVTIPLIAGKA
FT                   GVTPSTIYRRWGDLQELLADVAVDRLRPDMQPIDAGSGKADLETWAEQYAEEMSSGPGR
FT                   EMIRDVLAAQAGANACKCAEFTRQQVDVIAERAKARGEAFPDVDRVMDQVVAPIMYRIL
FT                   FGDVPATARVRDLVARVMSATD"
     atgacagtaa aagagaacct ccgtccgggc ggcagaagcg cccgggttca ggcatcggtg        60
     cacaaagcgg tccgtgagct gatggccgag atgagccgcg ccgaggtgac gatcccgctg       120
     attgccggca aggcgggggt aacgccgtcg accatctatc gccgctgggg cgacctgcag       180
     gagcttctcg ccgatgtcgc cgtcgatcgg ctgcggccgg atatgcagcc gatcgatgcc       240
     ggcagcggca aggccgatct cgaaacctgg gccgagcaat atgccgagga aatgtcctcc       300
     ggccccggcc gcgaaatgat ccgcgacgtg ctggcggcgc aggcgggcgc gaatgcctgt       360
     aaatgcgctg aatttacccg ccaacaggtc gacgtcatcg ccgagagggc caaggctcgc       420
     ggcgaggcct ttccggatgt cgaccgcgtc atggaccagg tcgtggcgcc gatcatgtac       480
     cgcatcctgt tcggcgatgt gccggcgaca gcgcgtgtgc gcgatctggt tgcgcgtgtc       540
     atgagcgcga cggactaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page