(data stored in ACNUC7421 zone)

EMBL: CP001622.PE251

CP001622.PE251       Location/Qualifiers
FT   CDS_pept        complement(262483..266007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0252"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; PAS fold-4 domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   histidine kinase A domain protein; KEGG: ret:RHE_CH00566
FT                   two-component sensor histidine kinase/response regulator
FT                   hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54563"
FT                   /db_xref="GOA:C6B0E4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54563.1"
FT                   /translation="MLPGWVIFASAFGYLLLLFAVASYGDRKNRSPGTLDRGRGTLEGG
FT                   WPVVYALSLAIYCTSWTYFGSVGLAAQRGLEFAGIYIGPILVFTLGMPLLRRIIELAKA
FT                   EKLTSVADFVAARYGKNPTVATIVALISLIGAIPYIALQLKAISSTVSAMVNPSDYGIG
FT                   SGNLYFLDLPLVATLVLACFAIMFGTRHTDATEHQDGLILAVSMESVVKLVAFLTAGVC
FT                   VIWFLFDGPTDLWRRTVDNELVMSALNYHTPISRWITLIILSAFAIILLPRQFHVTVVE
FT                   NRTPKQLKLAGILFPSYLIAINLFVLPVAIGGLLTFGGSGNADFYMLSLPLAGQMPVIS
FT                   LIIFIGGFSAATAMVIVDSVALSIMVSNDIIMPIFLRRKLAGRASLRDNFAKTLLNIRR
FT                   SAIFAVLLFGYAYYRSTDSTAGLASIGLLSFAAIAQIAPALFGGLIWRRANARGAILGL
FT                   SSGFIIWIYLLFLPSLGGPDYSYVASAVLGFIFPGTTLFTAPDADPLVNATAMSLLVNT
FT                   AFFVVGSLTRNAKPLERIQAGIFVKRHSRSQFATRGWKTRISVGDLKAAISRYLGEERM
FT                   QRSLTTYEQSSGRKLEDEQPADMALIHFSEQLLGSAIGSSSARLVLSLILQKIEDASSD
FT                   TAWLLDQASEALQYNQDMLQTALSQMDQGIAVFDSSNRLTIWNRRFRQLLDLPESAGQV
FT                   GFPLSDIVTTLIQRGDIAPGDLSQTVRHFLTLDKPFSLVLGGGERIIEVRSNAMPDKGI
FT                   VATFTDITQRVSADQALKQANETLEQRVAERTAELTRVNRELGEARAAADEANIGKTRF
FT                   FAAAGHDILQPLNAARLYSSALVERMAQSENSLIVRNIDSALESVETILGAVLDISRLD
FT                   TGAMRPRLASVALSDLLERIQTDFAPIAREKQLKLVIMPTSLRVRSDPNLLRRLVQNLV
FT                   SNAIKYTISGKVLVGARRRGNQVIIQVIDSGIGIPPSKFRTVFKEFARLDEGAKTASGL
FT                   GLGLSIVDRIARVLNHPVELQSTHGKGTEFRIAMPLDVSRPAAATAAITPADRPGQPLS
FT                   GLKILCIDNEPKILEGMRLLISGWGCEVEALDCLADVIALDGQEGPPDIVIADYHLGDG
FT                   TGIAAILHLRRQFGADIPALLITADRTPEVRSEAERDGIAVQHKPVRPAALRAYITQIS
FT                   GLKRAAAE"
     atgcttccag gctgggtcat attcgcgtct gccttcggct atctgctcct gcttttcgcc        60
     gtggcaagct atggcgaccg caagaaccgc agcccgggta cgctcgaccg cggccggggc       120
     acgctggaag gcggatggcc ggtggtctat gcgctgagcc ttgcgatcta ttgtacctcc       180
     tggacctatt tcggcagcgt cgggcttgcg gcgcagcgcg gcctggaatt tgccggcatc       240
     tatatcggcc ctatcctggt cttcacgctc ggcatgccgc tgcttcgccg catcatcgag       300
     cttgccaagg cggagaagct cacctcggtt gccgatttcg tcgccgcccg ttacggcaag       360
     aacccgacgg tcgcaacgat cgtcgccctg atctcgctga tcggcgccat tccctatatc       420
     gcgctgcagc tcaaggcgat ctcgagcacc gtcagcgcca tggtcaatcc gtccgattac       480
     ggcatcggca gcggcaatct ctattttctc gacctgccgc tcgtcgcaac gctggtgctt       540
     gcctgtttcg ccatcatgtt cggcacacgg catacggatg cgacagagca tcaggatggc       600
     ctcatcctcg ccgtctcgat ggaatccgtc gtcaagctcg tcgctttcct gacggccggc       660
     gtctgcgtca tctggtttct gttcgacggt ccgaccgatc tctggcgcag gaccgtcgac       720
     aatgagctgg tcatgtcggc gctcaactac catacgccga tcagccgctg gatcaccctg       780
     atcatcttgt cggcctttgc gatcatcctg ctgccgcggc aattccacgt gacggttgtc       840
     gaaaaccgaa ccccgaaaca gctgaaactc gcaggcatcc tgtttcccag ctatctcatc       900
     gccatcaatc tcttcgtgct gccggtggcg atcggcgggc tgctgacctt cggcggcagc       960
     ggcaatgccg atttctacat gctgtcgctg ccgcttgccg gccagatgcc cgtcatttcg      1020
     ctgatcatct tcatcggcgg gttctccgcc gcgacggcga tggtcatcgt cgattccgtc      1080
     gcactgtcga tcatggtgtc aaacgacatc atcatgccga tcttcctcag gcgcaaactc      1140
     gccggccgcg ccagcctgcg cgacaatttc gccaagacgt tgctcaacat ccgccgcagc      1200
     gccattttcg ccgtgctgct gttcggctat gcctattacc gttcgaccga cagcacggca      1260
     ggccttgcct cgatcggcct tctttccttt gccgcgatcg cgcaaatcgc cccagcactg      1320
     ttcggcgggc tgatctggcg gcgggcgaac gcgcgcggcg caatcctcgg gctttcctcc      1380
     ggcttcatca tctggatcta cctgctgttc ctgccctcgc tcggcggccc cgactattcc      1440
     tatgtggcga gcgccgtgct cggcttcatc tttcccggga cgacgttgtt caccgcgccc      1500
     gacgccgatc cgctggtcaa tgcgacggca atgagcctgc tcgtcaacac cgctttcttc      1560
     gtcgtcgggt cgctcacccg caacgccaag ccgctggagc gcatccaggc cggtatcttc      1620
     gtcaaacggc attcgcgctc gcaatttgcc acgcgcggct ggaagacccg cattagcgtc      1680
     ggcgatctca aggcggcgat ctcgcgctat ctcggcgaag agcgcatgca gcgctcgttg      1740
     acgacctacg aacaaagctc cggccgcaag ctggaagacg agcagccggc cgacatggcg      1800
     ctcatccatt ttagcgaaca gctgctcggc agcgccatcg gctcgtcctc ggccaggctg      1860
     gtgctgtcat tgatcctgca gaagatcgag gatgcctctt ccgataccgc ctggctgctc      1920
     gaccaggcga gcgaggcgct gcaatataac caggacatgc tgcagacggc gctttcgcag      1980
     atggaccagg gcattgcggt cttcgacagt tccaatcggc tgacgatctg gaaccggcgt      2040
     ttccggcaat tgctggatct tccggaaagt gccggccagg tcggttttcc cttgtctgat      2100
     atcgtcacca cgcttatcca gcgcggcgat atcgcgcccg gcgatctcag ccagacggtg      2160
     cggcatttcc tgacgctcga caagcccttt tcgctggtgc tcggcggcgg cgagcggatc      2220
     atcgaggtgc gctccaacgc catgcccgac aagggcatcg ttgccacctt caccgacatc      2280
     acccagcgcg tcagcgccga ccaggcactg aaacaggcga atgaaacgct ggagcagcgc      2340
     gtcgccgaac gcacggccga gcttacccgg gtcaaccgcg aactcggcga ggcgcgcgcc      2400
     gccgccgatg aggcgaatat cggcaagaca cgctttttcg ccgccgccgg ccacgatatc      2460
     ctgcagccgc tcaatgccgc caggctctat tcctcggcat tggtcgagcg catggcgcaa      2520
     tccgagaaca gcctgatcgt gcgcaacatc gattccgcgc tggaatcggt cgagaccatt      2580
     ctcggggcgg tgctcgatat atccaggctc gataccggcg ccatgcggcc gcggctcgcc      2640
     tccgtcgcgc tctccgacct gctggagcgt atccagaccg atttcgcgcc gatcgcccgt      2700
     gaaaaacagc tgaagctggt gatcatgccg acctcattgc gggtccgctc cgaccccaac      2760
     ctgctgcgcc ggctggtgca gaaccttgtc tccaacgcca tcaaatacac gatttcaggc      2820
     aaggtgctgg tgggcgcgcg acggcgcggc aaccaggtga tcatccaggt catcgattcc      2880
     ggcatcggca ttccgccgtc gaaattccgc accgtgttca aggaattcgc gcggctggac      2940
     gaaggcgcga aaaccgcctc cggcctcggg ctcggcctgt cgatcgttga ccgtatcgcc      3000
     cgcgtgctca accatccggt cgagctgcag tcgacgcatg gcaagggcac ggaattccgt      3060
     atcgccatgc cgctcgacgt ctcgcgcccg gccgcggcca cggcggcaat cacgcctgcc      3120
     gaccgtcccg gccagccgct gagcgggttg aagatcctct gcatcgacaa cgagccgaag      3180
     atcctcgaag gcatgcggct cttgatcagc ggctggggct gcgaggtgga ggcgctggat      3240
     tgcctcgccg acgtcatcgc cctcgacggc caggagggac cacctgatat cgtcatcgcc      3300
     gattatcatc tcggcgacgg caccggcatt gccgccatcc tgcatctgcg ccggcagttc      3360
     ggcgccgata tccccgcttt gctgatcacg gccgaccgca cgccggaggt gcgcagcgag      3420
     gccgagcgag atggtatcgc cgtccagcac aagccggtgc ggccggcggc gctacgcgcc      3480
     tatatcaccc agatttccgg cctcaagcgc gccgccgcgg agtaa                      3525
//

If you have problems or comments...

PBIL Back to PBIL home page