(data stored in ACNUC7421 zone)

EMBL: CP001622.PE252

CP001622.PE252       Location/Qualifiers
FT   CDS_pept        266230..266667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0253"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: rec:RHECIAT_CH0000640 large-conductance
FT                   mechanosensitive channel transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54564"
FT                   /db_xref="GOA:C6B0E5"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E5"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ACS54564.1"
FT                   /translation="MLNEFKAFIARGNVMDLAVGVIIGGAFGGIVKSLVDDLIMPIVGA
FT                   IFGGFDFSNYFLPLSSAVNAQSLAAAREQGAVFAYGSFLTVLINFLILAWIIFLMVKGV
FT                   NTLRAQVERQEKVAPEELPAPPADVQLLTEIRDLLATRPTA"
     atgctcaatg agttcaaggc ctttatcgcc cgcggcaatg tcatggatct tgcagtcggc        60
     gtcatcatcg gcggcgcctt cggtggcatc gtcaaatctt tggtggatga ccttattatg       120
     ccgatcgtcg gcgccatttt cggcggtttc gatttttcga attacttcct cccactgtcg       180
     tcggccgtca acgcacagtc gctcgccgcc gcccgcgagc agggagcggt gtttgcctat       240
     ggcagtttcc tcaccgtgct catcaacttc ctcattctcg cctggatcat ctttctgatg       300
     gtcaagggcg tgaacaccct gcgtgcccaa gtcgagcgcc aggaaaaggt ggcaccggaa       360
     gagctgccag cgccgccggc agacgttcag ctgctgacgg aaattcgcga tcttctcgcc       420
     acgcgcccga cggcttga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page