(data stored in ACNUC7421 zone)

EMBL: CP001622.PE253

CP001622.PE253       Location/Qualifiers
FT   CDS_pept        266790..267956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0254"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ret:RHE_CH00568 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54565"
FT                   /db_xref="GOA:C6B0E6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS54565.1"
FT                   /translation="MSIVSSLSPRALAAPESGIVELVNYARGREGLLPLWVGEGDLPTP
FT                   DFISRAAMDALASGETFYTWQRGIPELRQALSDYYDRHFGIRLPVEHFYVTGSGMQAIQ
FT                   IAVQALTSPGDELVYLSPSWPNIAAALEIAGARSLSVELQFEGGKWAVDLDRIETAITP
FT                   KTKGIFINTPSNPTGWTATKQDLGDLLALARKHDLWIMADEIYARYYFAGGRAPSFLDV
FT                   MEPDDKIIFVNSFSKNWSMTGWRVGWIVAPPEMGQVLENLIQYSTSGVAQFMQKGAVAA
FT                   LDQGDDFVAANIAKAARSRDTLCDALVATNRVETLKPDGAIYAFLKIDGVADSRTAALD
FT                   IVDKTGVGLAPGTAFGSGGELFLRACFLRDPTQVAIAAERLCDYILKL"
     atgtcgatcg ttagcagcct cagcccgcgc gcactggcgg cgcccgaaag cgggatcgtc        60
     gaactcgtca actatgcccg tggccgcgaa ggcctgctgc cgctctgggt gggtgagggc       120
     gacctgccga cgcctgattt catcagcagg gcggcgatgg acgcgcttgc tagcggcgag       180
     accttctaca catggcagcg cggcattccg gagcttcgcc aggcgctttc ggattattac       240
     gacagacatt tcggaatccg gcttccggtc gagcatttct acgtcaccgg ttccggcatg       300
     caggcgatcc agatcgccgt gcaggcgctg acctcgccgg gcgacgaact ggtttacttg       360
     tcaccttcct ggccgaacat tgccgccgct ctcgagatag caggtgcgcg ctcgctcagt       420
     gtcgagctgc agttcgaagg cggcaaatgg gcggtcgatc ttgaccgcat cgaaaccgcg       480
     atcaccccga agaccaaggg catcttcatc aacacgccgt cgaacccgac aggctggacg       540
     gcaacgaaac aggaccttgg cgatctcctg gcgcttgccc gcaagcacga cctctggatc       600
     atggcggacg aaatctacgc ccgctactat tttgccggcg gccgcgcccc ctctttcctc       660
     gatgtgatgg aaccggacga caagatcatc ttcgtcaatt ccttttcgaa gaactggtcg       720
     atgaccggct ggcgcgtcgg ctggatcgtc gccccgcctg aaatgggcca ggtgctcgaa       780
     aacctcatcc agtattcgac atcgggggtg gcgcagttca tgcagaaggg cgctgtcgca       840
     gcccttgatc aaggcgacga tttcgtcgct gccaatatcg ccaaggcggc ccgctcccgc       900
     gatactctct gcgatgcgct tgtcgccacc aaccgcgtcg agacactgaa accggatggc       960
     gcgatctatg ctttcctgaa gatcgacggc gtcgccgaca gccgcacggc agcgctcgac      1020
     atcgtcgaca agacaggcgt cggccttgct cccggcaccg ctttcggatc gggcggcgaa      1080
     ctcttcctgc gcgcctgttt cctgcgcgat cccacacagg tggcgatcgc cgccgagcgc      1140
     ctctgcgact atatcctcaa gctctga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page