(data stored in ACNUC7421 zone)

EMBL: CP001622.PE254

CP001622.PE254       Location/Qualifiers
FT   CDS_pept        268177..269211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0255"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: ret:RHE_CH00569 UDP-glucose 4-epimerase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54566"
FT                   /db_xref="GOA:C6B0E7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E7"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACS54566.1"
FT                   /translation="MAVLVTGGAGYIGSHMVWALLDAGEDVVVLDRLSTGFRWAVAPAA
FT                   RFYLGDVADPDILKKVFIENDIEAIIHFAGSAVVPVSVADPLSYYDNNSGKTRALLSAS
FT                   VKAGIRNFVFSSTAAVYGQQKTDLPVKETAPLNPENPYGQSKLMTEFMLRDAAAAYDFN
FT                   YVALRYFNVAGADPHHRAGQSTSGATHLIKVACEAALGRRDSVNVYGVDYPTHDGTGVR
FT                   DYIHVSDLTDAHLKALQHLRRSKGSLVANCGYGSGYSVLDVLNMVTRLHGHSFKIHMAP
FT                   RRAGDSASVVADASLARQVLDWKPRYDSLETIVQSSLDWELFLSNKNVDDLHSIHRALA
FT                   AASF"
     atggcggttt tggtgacggg cggcgccgga tatatcggca gtcacatggt ttgggcgctg        60
     ctcgatgcgg gcgaggatgt ggtcgtgctc gaccgcctct ccacaggctt tcgctgggcc       120
     gtggcgccgg cggcgcgttt ctatctcggc gacgttgccg atcccgacat attgaaaaag       180
     gtcttcatcg aaaacgacat cgaggcgatc atccatttcg ccggctccgc cgtcgtcccg       240
     gtctcggtcg ccgacccgct ctcctattac gacaacaatt ccggcaagac ccgggcgctg       300
     ttgagtgctt cggtcaaggc cggtatccgc aacttcgtct tctcttcgac ggcggctgtc       360
     tacggccagc aaaagaccga cctgcctgtg aaggagacgg ctccgctcaa tccggaaaat       420
     ccttacggcc agtcgaagct gatgaccgaa ttcatgctgc gcgatgccgc cgccgcctat       480
     gatttcaact atgtcgcgct tcgttacttc aacgtcgccg gcgccgaccc gcaccaccgt       540
     gccggccagt cgacctcagg cgccacacac ctgatcaagg tcgcctgcga ggcagcactc       600
     ggcaggcgcg acagcgtcaa tgtctacggc gtcgactatc ccacccatga cggcaccggc       660
     gtgcgcgact acatccatgt cagcgatctc acggatgcac atctgaaggc gctgcagcat       720
     ctgcgcagaa gcaagggctc gctcgttgcc aattgcggtt acggcagcgg ctattccgtg       780
     ctcgatgtgc tgaacatggt cacccgcctg cacggacatt ccttcaagat ccacatggcg       840
     ccgcgccgcg ccggcgattc ggcgagcgtc gtcgcagacg cttcgctcgc aaggcaggtg       900
     ctcgactgga aacccagata cgattcgctg gaaaccatcg tccagagttc gctcgattgg       960
     gaactgttcc tgtcgaacaa gaacgtcgac gacctgcaca gcatccaccg ggcattggcc      1020
     gccgcttcct tctga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page