(data stored in ACNUC7421 zone)

EMBL: CP001622.PE255

CP001622.PE255       Location/Qualifiers
FT   CDS_pept        269319..271280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0256"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: rec:RHECIAT_CH0000643 putative sensory
FT                   box/GGDEF family protein; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   SMART: EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54567"
FT                   /db_xref="GOA:C6B0E8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS54567.1"
FT                   /translation="MKNFLASLQLQKDNPTLLLAQFRALSSQIPILYVLLVINALAVAI
FT                   THLKSAPLWLSLYIPVALSVVCVFRLCWWEIRGKENVTAERAYRLMKLTISGAGILAVA
FT                   FGSWAIALYQYGDASQQGQIAYFLVVTGISCIFCLMHLPMAAALTTVITFSAMVATFLF
FT                   SGNPVFVATAISGLFLILPFLRVINSYFQNFVGLVQLTEELKQKQAEAEELNLVNSRNA
FT                   LHDQLTGLANRRSFFLSLEKRLQKDSSTPPVLGILDLDGFKPVNDVFGHAAGDLVLKET
FT                   ARRFVALVGEEGIVSRLGGDEFGIIFPSLMTRQAIADLGQALCAAVRDPFEIPDGSVRV
FT                   FGSCGIVYPDIGTYTAEDLYEKADFALYQVKSKRSSGVEFFSAEHEKILTQRHLIELEL
FT                   QANDFAKELKLDYQPIVELRSGRVVAYEALARWDSARFGRISPDAFIPAAERTAVIGRI
FT                   TRILFAKALEALAIIPRHLRLSFNLSARDICDHETSMALLAMITRSGIDPKRIEFEITE
FT                   TALLSDFDTADQVISMLRAAGISIALDDFGTGYSSLSHIHRLGFDKLKIDKSFVMNFDR
FT                   DARCMNITRSVANLCQNLGIASVAEGVESEEIAEGLKAMGVRLAQGYHFSRPLPLELAI
FT                   DYAARCEAAASARNSLSA"
     atgaagaact ttctggcctc attgcagctg caaaaagaca atccgacgct tctgctggcg        60
     cagttccggg ccctgtcgtc gcagattccc attctctatg tccttctggt catcaacgcc       120
     cttgcggtgg cgatcaccca cctcaaatcc gccccccttt ggctctcgct ctacattccc       180
     gtggccttga gcgtcgtctg tgtcttccgt ctctgctggt gggagatccg cggcaaggaa       240
     aacgtcaccg ccgagcgggc ctacaggctg atgaagctca cgatatcagg ggccggcatc       300
     ctggccgtcg ctttcggcag ctgggcgatc gcgctctacc aatatggcga tgcttcccag       360
     cagggtcaga tcgcctattt cctcgtcgtg accgggatat cctgcatctt ttgcctgatg       420
     cacctgccga tggcggcagc gctgaccacg gtcatcacct tctcggccat ggtcgcgacc       480
     ttcttgttct cgggcaatcc cgttttcgtc gcgacggcca ttagcggcct cttcctgatc       540
     ctgcccttcc tcagggtgat caacagctat ttccagaatt tcgtcggtct cgtgcaactg       600
     accgaagagc tgaagcagaa gcaggcggaa gccgaagagc tgaacctcgt caacagccgc       660
     aatgcgctgc atgaccagct gaccggcctt gccaatcgcc gcagcttctt tctctcgttg       720
     gaaaaacggc tgcagaagga ttcgtcgacg ccgcccgtcc tcggcattct cgatctcgac       780
     ggcttcaagc cggtcaacga cgtcttcggc catgccgccg gcgatctcgt gctgaaggag       840
     acggcccgcc gcttcgtcgc gctggtcggc gaagagggca tcgtctcccg tctcggcggc       900
     gatgagttcg gtatcatctt tccctccttg atgacgcgcc aggcgatcgc cgatctcggc       960
     caggcgctct gtgctgccgt ccgcgatcct ttcgaaatcc ccgacggctc ggtccgcgtc      1020
     ttcggctcct gcggcatcgt ctatcctgat attggcacat acaccgccga ggatctttac      1080
     gagaaagccg attttgccct ctaccaggtc aagagcaagc gcagcagcgg cgtcgaattc      1140
     ttctcggccg agcacgagaa gatcctgacg cagcgccacc tgatcgaact cgaactgcag      1200
     gcaaacgatt tcgccaagga attgaaactc gactatcagc cgatcgtcga attgaggagc      1260
     ggccgcgtcg tcgcctacga ggcgctcgcc cgctgggaca gcgcccgctt cggccgtatc      1320
     agcccagacg ccttcattcc cgctgccgag cgcacggcgg tcatcggtcg cataacccgc      1380
     atcctcttcg ccaaggcgct cgaagcgctg gcgatcattc cacggcatct caggctgtcc      1440
     ttcaatctct cggcgcgcga tatctgcgac cacgagacct cgatggcgct gctcgccatg      1500
     atcacccgtt ccggcatcga tccgaagcgc atcgaattcg agattaccga gaccgcattg      1560
     ctctccgatt tcgacaccgc cgatcaggtg atatccatgc tgcgcgctgc cggcatctcg      1620
     attgcgctcg acgatttcgg caccggctat tcgagcctca gccatattca tcgtctcggc      1680
     ttcgacaagc tgaagatcga caagtcgttc gtgatgaatt tcgatcgaga cgcccgctgc      1740
     atgaacatca cccgctcggt cgccaatctc tgccagaacc tcggcatcgc ctccgtcgcc      1800
     gaaggcgtcg aaagcgaaga gattgccgag ggattgaagg cgatgggcgt tcgtctggcg      1860
     cagggctatc atttctcgcg gccgctgccg ctcgaacttg ccatcgacta cgccgccagg      1920
     tgcgaggccg cagcctccgc ccgcaattcg ctgtctgcct ga                         1962
//

If you have problems or comments...

PBIL Back to PBIL home page