(data stored in ACNUC7421 zone)

EMBL: CP001622.PE256

CP001622.PE256       Location/Qualifiers
FT   CDS_pept        271364..272416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0257"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rec:RHECIAT_CH0000644 probable enoyl-CoA hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54568"
FT                   /db_xref="GOA:C6B0E9"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0E9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS54568.1"
FT                   /translation="MQDGEVIIERRGTAGVIRLNRPRALNSLTLPMIRTITAALHDFAG
FT                   DPEVASVVATGEGERGFCAGGDIRALHESARAGDGLAASFWREEFRLNHMIASYPKPYV
FT                   ALMDGITMGGGVGLSSHGRHRIVTERTRLAMPETGIGYVPDVGATWLLPRGPGEAGTWL
FT                   GLTGLDIGAADAIHARLADLQIASSRLGEAIDALSALPRASSSGDVDAVLQALPEPQGE
FT                   SRLRQNAAMIDRAFCFDNVEEILATLAEEEGEFAAETRRVLLTRSPTSLKLALRLLRAG
FT                   RSSASLAECLGRELGACLRMLDNPDFFEGIRAAVIDKDRNPKWSPASVEAVEVARVEHF
FT                   LKPAEPPLSL"
     atgcaggacg gcgaagtcat cattgaacgg cggggtaccg caggcgtcat ccggctcaac        60
     cggccgcgag cactgaacag cctgacgttg ccgatgatcc gcacgatcac cgcggccctt       120
     cacgactttg ccggtgatcc cgaggtggcg agcgtcgtgg cgacgggaga gggcgaacgc       180
     ggcttctgcg ccggcggcga tatccgcgcc ctgcatgaga gcgcccgcgc cggcgatggc       240
     ctggcggcaa gcttctggcg cgaggagttc cgcctcaacc atatgattgc ctcctatccc       300
     aagccctatg tcgcgctgat ggacggcatc accatgggcg gcggcgtcgg cctgtcctcg       360
     catggtcgcc accgcatcgt caccgagcgc acccgccttg ccatgcccga aaccggcatc       420
     ggctatgtcc cggatgtcgg cgccacctgg ctgctgccgc gtggccccgg cgaggccgga       480
     acatggctcg gtctgacagg gcttgatatc ggggctgccg atgcgatcca cgcccgcctt       540
     gccgaccttc agatcgcctc gtcgcggctc ggcgaagcga tcgatgctct ctccgccctg       600
     ccgcgcgcca gctcatccgg cgatgtcgat gccgtgctgc aggcgcttcc ggagcctcag       660
     ggagaaagcc ggctcaggca gaacgcggcg atgatcgatc gcgcattttg tttcgacaac       720
     gtggaggaga tcctggcaac gcttgccgag gaggaaggcg aattcgccgc cgagacgcgc       780
     cgggtgctgc tgacgcgttc accgaccagt ctgaagctcg ctttgcggct gctcagagcc       840
     ggccgcagca gcgcctcgct tgccgaatgc ctcggccgcg aactcggcgc ctgcctgcgg       900
     atgcttgata atcccgattt cttcgagggt attcgcgccg ccgtcatcga caaggaccgc       960
     aatccgaaat ggtcgcccgc atcagtcgag gctgtggaag tggcaagggt cgagcatttc      1020
     ctgaaaccgg ccgaaccgcc gctttcgctc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page