(data stored in ACNUC7421 zone)

EMBL: CP001622.PE257

CP001622.PE257       Location/Qualifiers
FT   CDS_pept        complement(272428..274485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0258"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rec:RHECIAT_CH0000646
FT                   ATP-dependent DNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54569"
FT                   /db_xref="GOA:C6B0F0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F0"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACS54569.1"
FT                   /translation="MYLEKLNPQQRMAVEHGTLIDGSHIAGPLLVIAGAGSGKTNTLAH
FT                   RVAHLIVKGADPRRILLMTFSRRAAAEMARRVERICRDVLGANAGVMADALSWSGTFHG
FT                   IGARLLRDYAEQIGLDPGFTIHDREDSADLMNLIRHDLGFSKTESRFPTKGTCLAIYSR
FT                   AVNSETALDLVLRDVFPWCATWEKQLRELFASYVEAKQSQNVLDYDDLLLYWAQMVGEA
FT                   MIAEDIGSRFDHVLVDEYQDTNRLQASILLALKPQGQGLTVVGDDAQSIYSFRAATVRN
FT                   ILDFPAAFSPAANIVTLDRNYRSTQPILAAANAVIDLASERFTKNLWTERQSSERPRLV
FT                   TVRDEAEQARYITDMVLDNREEGLTLKQQAVLFRASHHSGPLEVELTRRNIPFVKFGGL
FT                   KFLDSAHVKDMLAALRFAQNPRDRVAGFRLMQILPGVGPSTAQKTLDLMAEDASPITAL
FT                   GAMPAPPRSGEDWTMFVAMLQELKTGKAGWPAEIGLARQWYAPHLERLHEDAATRQADL
FT                   LQLEQIASGYASRERFLTELTLDPPDATSDQAGVPLLDEDYLILSTIHSAKGQEWTKVF
FT                   MLNVVDGCIPSDLAVGTTAEIEEERRLLYVAMTRARDGLDLVVPQRFFTYGQNSQGDRH
FT                   VYASRSRFIPATLLQFFEACSWPQVKSEAAQAHARQVRIDVGARMRGMWR"
     atgtatctcg aaaagctcaa tccgcagcag cgcatggccg tcgagcacgg cacgctcatc        60
     gacggcagcc atattgccgg gccgctgctg gtcattgccg gcgccggctc cggcaagacg       120
     aataccttgg cgcatcgggt cgcccatctg atcgtcaagg gcgccgatcc ccgccgcatc       180
     ctgctgatga ccttctcgcg ccgggcagcc gccgagatgg cgcggcgtgt cgagcgcatc       240
     tgccgcgatg tgcttggtgc gaatgctggc gtgatggcgg atgcgctttc ctggtccggc       300
     accttccacg gcatcggcgc gcggctgttg cgcgattatg cggagcagat cggtctcgat       360
     cctgggttta ccatccacga ccgcgaagac agtgccgatc tgatgaacct gatccggcac       420
     gacctcggct tctcgaagac ggaaagccgc tttcccacaa agggcacctg ccttgccatc       480
     tattccaggg cggtgaattc ggaaaccgcg ctcgacctcg tgctgcgcga cgtctttccc       540
     tggtgcgcga cgtgggagaa acagctgcgc gaacttttcg ccagttatgt cgaggccaag       600
     cagagccaga acgtgctcga ttacgacgat ctgctgctct actgggcgca gatggtcggc       660
     gaagcgatga ttgccgagga tatcggcagc cgcttcgacc atgtgctggt cgacgaatat       720
     caggatacca accggttgca ggcctcgatc ctgctcgcat tgaaacccca aggccaaggg       780
     ctgaccgtcg tcggcgacga tgcgcagtcg atctattcct tccgtgccgc gacggtgcgc       840
     aacatcctcg attttcccgc cgccttcagc ccggcggcca atatcgtcac gctcgaccgc       900
     aactaccgct cgacgcagcc gatcctcgcc gccgccaacg ccgtcatcga tctcgcctcg       960
     gagcgcttca ccaagaacct ctggaccgag cggcaatcgt ccgagcggcc gcgcctggtc      1020
     actgtgcgcg acgaggccga gcaggcgcgg tatatcaccg acatggtgct cgataaccgc      1080
     gaggaaggcc tcacgctcaa gcagcaggcc gtgctctttc gcgcctcgca tcacagcggg      1140
     ccgctggagg tcgagctgac ccggcgcaac attcctttcg tcaagttcgg cgggctgaag      1200
     tttctcgaca gcgcgcatgt gaaggacatg ctggccgccc ttcgcttcgc gcagaacccg      1260
     cgcgaccggg tggcgggctt ccggctgatg cagatcctgc cgggcgtcgg cccgtcgacg      1320
     gcacagaaga cgctcgacct gatggccgag gatgccagcc cgattactgc tcttggcgcc      1380
     atgccggcac cgccgcgctc cggcgaggac tggacaatgt tcgttgcgat gctgcaggag      1440
     ctgaagaccg gcaaggccgg ctggccggca gagatcggcc tggcacggca atggtacgcg      1500
     ccgcatctgg aacggctgca cgaggacgca gcaacgcggc aggccgacct gctgcagctc      1560
     gagcagatcg ctagcggtta tgcctcgcgc gagcgctttc tcaccgagct caccctcgat      1620
     ccgccggatg cgaccagcga ccaggcgggt gtgccgcttc tcgacgaaga ctatctcatc      1680
     ctgtcgacca tccattccgc caagggccag gaatggacga aggtcttcat gctgaacgtc      1740
     gtcgacggat gcataccgag cgatctcgcc gtcggcacaa ccgccgaaat cgaagaggaa      1800
     cgccggctgc tctatgtcgc gatgacgcgc gcccgggatg gtctcgacct cgtcgttccg      1860
     caacgcttct tcacctatgg gcagaactcg cagggcgacc ggcatgtcta tgcctcacgc      1920
     agccgcttca ttccggcaac gctgctgcag ttcttcgagg cctgcagctg gccgcaggtg      1980
     aaatcggagg ccgcgcaagc ccacgcgcgg caagtgcgca tcgatgtcgg cgcccgcatg      2040
     cgcggcatgt ggcgatag                                                    2058
//

If you have problems or comments...

PBIL Back to PBIL home page