(data stored in ACNUC7421 zone)

EMBL: CP001622.PE258

CP001622.PE258       Location/Qualifiers
FT   CDS_pept        complement(274593..274859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54570"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F1"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00574"
FT                   /protein_id="ACS54570.1"
FT                   /translation="MKALLPALFAGAMLAGCSSADTRALEPIPGSITYGGQPRTKLAKS
FT                   PVGSAVYNQFYNGTGQRVEETYILQPDRSLKLVRREIGPDFPD"
     atgaaagcgc ttctgcccgc cttgtttgcc ggggcaatgc ttgccggctg ctcctcggcc        60
     gatacgcggg cgctggaacc cattcccggc agcattacct atggcggcca gccgcgaacg       120
     aagcttgcca agtcgccggt cggcagcgcc gtctacaacc agttctacaa cgggacgggc       180
     cagcgcgtgg aggaaaccta tattcttcag ccggaccgta gcctgaagct ggtgcggcgc       240
     gagatcggtc cggatttccc cgactga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page