(data stored in ACNUC7421 zone)

EMBL: CP001622.PE259

CP001622.PE259       Location/Qualifiers
FT   CDS_pept        275038..275298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0260"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG:
FT                   rec:RHECIAT_CH0000648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54571"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F2"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACS54571.1"
FT                   /translation="MLGFPAFTGHGEPGRQGHSDAATRASVESALHAAADFEAGEITVS
FT                   ISGSYVILEGFVRRRGDVERAIEIAEGVVGRGYVRARLLRR"
     gtgctcggct ttccagcatt cacggggcat ggcgagcccg gccgccaggg ccacagcgat        60
     gccgcgacgc gcgcctcggt ggaaagcgcc cttcatgcgg ccgccgattt cgaagccggc       120
     gaaatcaccg tcagcatatc gggctcctat gtcatcctgg aaggtttcgt gcgccggcgg       180
     ggcgatgtcg agcgggcgat cgagatcgcc gagggcgtcg tcggccgggg ctatgtgcgt       240
     gctcgcttgc tgcgacgcta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page