(data stored in ACNUC7421 zone)

EMBL: CP001622.PE26

CP001622.PE26        Location/Qualifiers
FT   CDS_pept        25147..25437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0026"
FT                   /product="chorismate mutase"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase;
FT                   KEGG: oan:Oant_1078 chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54338"
FT                   /db_xref="GOA:C6AYB4"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB4"
FT                   /inference="protein motif:TFAM:TIGR01795"
FT                   /protein_id="ACS54338.1"
FT                   /translation="MTSTFPHELLALRASIDNIDAALMHMLAERFRCTKAIGALKARQG
FT                   LPASDPEREQSQIQRLRSLASTSGLDPDFAEKFLTFTIDEVIRHHRAAAAR"
     atgacatcga cttttccgca cgagctcctc gccttgcgtg cctcgataga caacattgac        60
     gccgcgttga tgcatatgct ggcagaacgt ttccgttgca caaaggcgat tggggcgctc       120
     aaggctaggc aaggactccc cgcctctgat cccgagcgcg aacaatcaca gatccaaaga       180
     ctgcgctcac tcgcgtcgac atcgggttta gaccctgact ttgccgagaa atttctgacc       240
     ttcacgatcg acgaagtgat ccgacaccat cgggcagccg cggcaaggtg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page