(data stored in ACNUC7421 zone)

EMBL: CP001622.PE260

CP001622.PE260       Location/Qualifiers
FT   CDS_pept        275390..275653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54572"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F3"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000649"
FT                   /protein_id="ACS54572.1"
FT                   /translation="MQLLPRLWATTLIVGCGVFAGSAHASLETGTNYSALPKDQIALNE
FT                   YTGTVACQPVEPHYLPSFIRAADGTIIGVGYVEIENESGADC"
     atgcagttgc ttcctcgcct ctgggcaacc accttgatcg tgggttgcgg tgtctttgcc        60
     ggctccgccc atgcctcgct ggaaaccggc acgaattatt ccgctttgcc gaaggaccag       120
     atcgccctca acgaatatac cgggaccgtc gcctgccagc cggtagagcc tcactatctc       180
     ccctccttca tccgcgcggc agatggcacc atcatcggtg tcggttatgt cgagatcgag       240
     aatgagagcg gcgcggattg ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page