(data stored in ACNUC7421 zone)

EMBL: CP001622.PE262

CP001622.PE262       Location/Qualifiers
FT   CDS_pept        276526..276888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54574"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F5"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000651"
FT                   /protein_id="ACS54574.1"
FT                   /translation="MPVLARGAEVSAEDALLTRLSIETVPRLQREYLRATLTPQDEGTA
FT                   IDVAAYVLSKTFDRWYVEGIFDGAFSWLHAPIKDEVLVTRELIELWQFSPFISYYLEVT
FT                   EIPDCANNSVLLPSCH"
     atgccggtcc tcgcccgcgg ggcagaggtg tctgctgaag acgctctgct gacgcgtctc        60
     tccatcgaaa ccgtgccacg actccagcgg gaatatttgc gggcgaccct cacgccccag       120
     gatgaaggca cggcgataga tgttgctgcc tatgttttgt ctaagacttt tgatcggtgg       180
     tatgtcgaag gtatattcga tggagctttt tcgtggcttc acgcgccaat taaggacgaa       240
     gtgctggtca ccagagaact gattgaactg tggcagtttt cgccgtttat atcttactat       300
     ctcgaggtaa ccgagattcc cgactgcgca aacaacagcg tgctgcttcc cagctgtcac       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page