(data stored in ACNUC7421 zone)

EMBL: CP001622.PE264

CP001622.PE264       Location/Qualifiers
FT   CDS_pept        277464..278756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0265"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="KEGG: rec:RHECIAT_CH0000654 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase protein; TIGRFAM:
FT                   UDP-N-acetylglucosamine 1-carboxyvinyltransferase; PFAM:
FT                   EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54576"
FT                   /db_xref="GOA:C6B0F7"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F7"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACS54576.1"
FT                   /translation="MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVP
FT                   HLADVELLMRILGNHGVDVAVNGRRERQEDAYSRTIHFTCRTIVDTTASYELVSKMRAS
FT                   FWVIGPLLAREGHCRVSLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPAGGL
FT                   IGARYTFPKVSVGATHVMMMAATLARGTTVIGNAAREPEVVDLANCLNAMGARISGAGT
FT                   ATITIEGVTSLSGARHRVLPDRIETGTYAMAVAMAGGDVVLENTDVALLETAVETLRRA
FT                   GAEISSTNNGMRIKRNGAGIRPVDIVTDPFPGFPTDLQAQFMALMTRSSGVSHVTETIF
FT                   ENRFMHVQELARLGARISLSGQTAKIEGVQRLRGAPVMATDLRASVSLVIAGLAAEGET
FT                   TVSRVYHLDRGFERLEEKLTRCGAIVERISE"
     atggatcgta tcagaatcgt cggcggtaat gagctgaatg gcatcattcc gatttccggc        60
     gccaagaatg ccgcactgcc gctgatgatc gcctcgcttc tgaccagcga tacgctgacg       120
     ctcgaaaacg tgccgcatct ggccgatgtc gagctgctga tgcgcatcct cggcaatcac       180
     ggcgtcgacg tcgccgttaa cggccgccgc gagcgccagg aagacgccta ttcgcgcacg       240
     atccatttca cctgccgcac catcgtcgat acgaccgcat cttatgaact ggtctcgaag       300
     atgcgcgcct ccttctgggt catcggcccg ttgctggcgc gcgaaggcca ttgccgcgtt       360
     tcgctgccgg gcggctgtgc catcggcacg cgccccgtcg atctcttcat cgaaggcctg       420
     acggcgctcg gcgccacgat ggaaatcgat gccggttata tcaacgccaa ggcgcctgcc       480
     ggcggcctga tcggcgcacg ctacaccttc ccgaaggtct ccgtcggcgc cacccatgtg       540
     atgatgatgg cggcaacgct tgcccgcggc acgactgtca tcggcaatgc cgcccgcgag       600
     cctgaggtcg tcgacctcgc caactgcctg aacgccatgg gcgccaggat atcgggcgcg       660
     ggtacggcga cgatcaccat cgaaggcgtc acctcgctct ccggcgcccg ccatcgcgtc       720
     ctgccggatc gcatcgagac cggcacctac gccatggcgg tcgccatggc cggtggcgac       780
     gtcgtgctcg aaaataccga tgtggcgctg ctcgaaaccg cggtggaaac gttgcgccgc       840
     gccggcgcgg aaatctcgtc gaccaacaat ggcatgcgca tcaagcgcaa tggcgccggc       900
     atcaggccgg tcgatatcgt caccgatcct ttcccgggtt tcccgaccga cctgcaggcg       960
     cagttcatgg cgctgatgac ccgttcttcc ggcgtctcgc atgtcaccga gaccatcttc      1020
     gaaaaccgtt tcatgcatgt gcaggagctt gcccgcctcg gcgccaggat ctcgctgtcc      1080
     ggccagacgg cgaagatcga gggtgtccaa cgcctgcgcg gtgcgcctgt tatggcaacc      1140
     gatctgcgcg cctccgtctc gctggtcatc gccggccttg ccgccgaggg cgaaaccacg      1200
     gtctcccgcg tctatcacct cgaccgcggt ttcgagcggc tcgaggagaa gctgacccgt      1260
     tgcggcgcca tcgtcgagcg catcagcgag taa                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page