(data stored in ACNUC7421 zone)

EMBL: CP001622.PE265

CP001622.PE265       Location/Qualifiers
FT   CDS_pept        278865..279296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54577"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F8"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000655"
FT                   /protein_id="ACS54577.1"
FT                   /translation="MTDLKLVALDNEDLAIMSAHMQDSVFKVGDIDWSPRDAQFALAAN
FT                   RFVWEGAERKRKGFERRRAALVFKRVLAVRSLGIDRGKRDEVLSLLALRFEQKGEGPEG
FT                   TIELSLSGTASIALDVECIEVQLADIGGAWEASSKPRHR"
     atgaccgacc tgaaacttgt tgcgctcgat aacgaggatc ttgcgatcat gtccgcgcat        60
     atgcaggaca gtgtcttcaa ggtcggcgac atcgattggt cgccgcgcga cgcgcagttc       120
     gcgcttgccg ccaatcgttt cgtctgggaa ggtgccgagc gcaagcgcaa gggtttcgag       180
     cgccgccgtg ctgccctggt tttcaagcgc gtgcttgccg tccgttcgct cggcattgat       240
     cgcggcaaac gcgacgaggt gctgtcgctg ctggcgctgc gcttcgagca aaagggcgag       300
     gggccggagg gcacgatcga gctgtccctg tccggcaccg cctcgattgc gctcgatgtc       360
     gaatgcatcg aggtccagct ggccgatatc ggcggcgcct gggaggcttc ctccaagcct       420
     cgtcaccgct aa                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page