(data stored in ACNUC7421 zone)

EMBL: CP001622.PE266

CP001622.PE266       Location/Qualifiers
FT   CDS_pept        279413..280711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0267"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: rec:RHECIAT_CH0000656 histidinol dehydrogenase
FT                   protein; TIGRFAM: histidinol dehydrogenase; PFAM:
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54578"
FT                   /db_xref="GOA:C6B0F9"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0F9"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ACS54578.1"
FT                   /translation="MAIWLDQASEGFEQHFAAFLTTKREVSEDVNVVVRTIIDDVRARG
FT                   DVALAEYSLKFDSIDYATVPMRVTAEEIDAAVEAVPSEVLGALKLAALRIESHHRRQLP
FT                   KDDIYEDDMGVSLGSRWTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPA
FT                   TGGAVNPAVLAAAKLVGVTEIYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKR
FT                   HVFGTVGIDMIAGPSEVLVIADKDNNPDWIAADLLAQAEHDVSSQAILITDDAAFGKAV
FT                   EQAVERQLKTLNRAETAAASWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLL
FT                   DGIRNAGAIFIGAHTPEVIGDYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQ
FT                   QLRTLGPAAIALAVSEGLDAHARSVAIRLNLER"
     ttggcaatct ggctggatca ggcatcggaa ggtttcgagc agcattttgc cgcctttctg        60
     acgacgaagc gtgaagtctc cgaggatgtg aacgtggtcg ttcgcaccat catcgatgac       120
     gtgcgcgccc gtggcgatgt ggcgcttgcc gaatattcgc tgaaattcga cagcatcgac       180
     tacgctaccg tcccgatgcg tgtcacagct gaagagatcg acgccgccgt cgaggcggtg       240
     ccttcggaag tgctgggggc gctgaagctc gcggcgctgc gcatcgaatc ccatcatcgc       300
     cggcaactgc cgaaggacga tatctatgag gacgacatgg gcgtcagtct cggctcgcgc       360
     tggacggcga tcgaagcggt cgggctctat gttccgggcg gcaccgcgag ttatccgagc       420
     tcggtgctga tgaatgcggt gccggccaag gtcgccggcg tcgatcgcat cgtcatcgct       480
     gttcctgcca caggcggcgc cgtcaatccg gcggtgcttg ccgccgccaa gcttgtcggc       540
     gtcaccgaga tttaccgtgt cggcggcgcc caggcgatcg cggctcttgc ttatggcacc       600
     gagacgatcg ccccggtcgc caagatcacc ggccccggca atgcctatgt cgctgctgcc       660
     aagcgtcatg tcttcggcac cgtcggcatc gatatgatcg ccggtccctc cgaagtgctt       720
     gtcattgcag acaaggacaa caatccggat tggattgcag ccgatctctt ggcccaggcc       780
     gagcacgacg tcagttccca ggcgatcctg atcaccgacg atgccgcatt cggcaaggcg       840
     gtggagcagg cggtcgaacg ccagctgaag acgctgaacc gggccgagac ggcggcagca       900
     agctggcgcg atttcggcgc ggtcatcctg gttgccgatc tgaaacaggc cattcccttg       960
     gcaaaccgta tcgctgccga gcatctggag ctcgccgtcg ccgatccgga ccggctgctc      1020
     gacggcatcc gcaatgccgg cgcgatcttc atcggcgccc atacgcccga ggtgatcggc      1080
     gattatgtcg gcggttcgaa ccacgtgctg ccgacggcgc gttcggcacg tttctcctcc      1140
     ggcctttcgg tgctcgattt cgtcaagcgc acctcgatcc tgcgcctcgg cccgcagcag      1200
     ctccgcaccc tcggcccggc ggcgatcgcc cttgccgttt ccgaaggcct cgatgcccat      1260
     gcgcgatcgg tcgcgatccg cctcaacctc gaaaggtga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page