(data stored in ACNUC7421 zone)

EMBL: CP001622.PE267

CP001622.PE267       Location/Qualifiers
FT   CDS_pept        280716..281189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ret:RHE_CH00582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54579"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G0"
FT                   /inference="protein motif:PFAM:PF06793"
FT                   /protein_id="ACS54579.1"
FT                   /translation="MAKGEFRLCDVVLDDTIGRSTPDVEHERAVAIFDLIEENRFEPLG
FT                   HAGGPYRLNISLVDSKLVFAITTEEGGGVATHILSLTPFRRIVKDYFMICESYYEAIRS
FT                   STPSRIEAIDMGRRGIHNEGSQTLKDRLAGKIEVDFDTARRLFTLVCVLYWRG"
     atggcgaagg gcgaattccg gctttgcgac gtcgtccttg acgatacgat cggccgttcg        60
     acgcccgatg tcgagcatga gcgcgccgtc gccatcttcg acctgatcga ggaaaacagg       120
     ttcgagccgc tcggccatgc cggcggtcct taccggctga acatctcgct ggtcgattcg       180
     aagctggtat tcgccatcac caccgaagaa ggcggcgggg tcgccaccca tatcctgtcg       240
     ctcacgccct tccggcggat cgtcaaggat tacttcatga tctgcgagag ctattacgaa       300
     gcgatccgtt cgtcgacgcc gagccgcatc gaggcgatcg acatgggccg gcgcggcatc       360
     cacaatgaag gctcgcagac gctgaaggat aggctggccg gcaagataga ggtcgatttc       420
     gataccgccc ggcgcctttt cacgctggtc tgcgtgctct actggcgcgg atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page