(data stored in ACNUC7421 zone)

EMBL: CP001622.PE268

CP001622.PE268       Location/Qualifiers
FT   CDS_pept        281195..281671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0269"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: rec:RHECIAT_CH0000658 putative arsenate
FT                   reductase (phosphatase) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54580"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G1"
FT                   /inference="protein motif:SMART:SM00226"
FT                   /protein_id="ACS54580.1"
FT                   /translation="MELAVDVEEGKRPGAILFMCGMNAIRSPMAEAIARSILPANTYIR
FT                   SAGVRAGERDPFVDVVLEEIGLSLGRRQPQTLEELEDDYFDLIITLSPQAHHAALELTR
FT                   SSAVDVVYWPTMDPTVAIGTREQILESYREVRDHLAGLIESRLLKRNGIAAQSA"
     atggagctcg ccgtcgacgt cgaggaggga aagcggccgg gcgccatcct cttcatgtgc        60
     ggtatgaatg ccatccgctc gccgatggcc gaagcgatcg cccgtagcat tctgcccgcc       120
     aatacctata tcaggtctgc cggcgtacgc gccggcgagc gcgatccctt cgtggacgtc       180
     gtgctcgagg agatcgggct ttccctcggg cgccgccagc cgcagacgct ggaagaactc       240
     gaggatgatt atttcgatct gatcatcacg ctgtcaccgc aggcccatca tgcagcactc       300
     gagctgaccc ggtcgagtgc ggtcgatgtg gtctactggc cgacgatgga tccgacggtt       360
     gcaatcggaa cacgcgagca gattctggag agctaccgcg aggtccgcga tcatctggcc       420
     ggcctcatcg aaagccgact actcaaacga aatggcattg ccgcgcaatc ggcatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page