(data stored in ACNUC7421 zone)

EMBL: CP001622.PE27

CP001622.PE27        Location/Qualifiers
FT   CDS_pept        complement(25777..26910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0028"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: rec:RHECIAT_CH0000413
FT                   putative hemolysin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54339"
FT                   /db_xref="GOA:C6AYB5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB5"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACS54339.1"
FT                   /translation="MSDFTTKPAADAKDSEPSSSSDEAGSSSRPSGRSQSFWSRAARIL
FT                   RPQQGSRLREDLADALMTDAAGDDAFSPDERAMLNNILRFREVRVADVMVPRADIEAVD
FT                   QNITIGELMILFEESGRSRMPVYADTLDDPRGMVHIRDLLSYVAKQARNKRRGPAKPAA
FT                   AVPAIEVAPENIHKATRSAKPNFDLARVDLQKTLAEAGIVRKILFVPPSMLASDLLRRM
FT                   QVNRTQMALVIDEYGGTDGLASHEDIVEMVVGDIDDEHDDEEVMFKRVAEDMFIADARV
FT                   ELEEIAQAIGPDFDISEQVDEVDTLGGLIFSALGRIPVRGEVVQALPGFEFHILDADPR
FT                   RIKRLRITRKRHAIRRRAKADGDAAPGDDRPAESTAN"
     atgagcgact ttacgacgaa gccggcggca gacgccaagg actccgagcc atcctcctct        60
     tccgacgagg cgggcagtag tagtcggcca tccggccgat cgcaatcctt ctggtcgcgc       120
     gccgcgcgta tccttcgccc gcagcagggc tcgcgactgc gtgaggatct cgccgacgcg       180
     ctgatgaccg atgcggccgg cgacgacgcc ttttcgcccg acgaacgggc gatgctcaac       240
     aacatcctgc gttttcgcga ggtccgcgtc gccgacgtga tggtgccgcg cgccgatatc       300
     gaggcggtcg accagaacat caccatcggc gagctgatga tcctcttcga ggaatccggc       360
     cgctcgcgca tgcctgtcta tgccgatacg ctcgacgatc cgcgcggcat ggtgcacatt       420
     cgcgacctgc tctcctatgt cgccaagcag gcgcgcaaca agcgccgcgg cccggcgaag       480
     ccggccgctg ccgtgccggc gatcgaggtc gcgcccgaaa acatccacaa ggccacgcgt       540
     tcggccaagc cgaatttcga tctcgcccgt gtcgacctgc aaaagacgct ggccgaggcc       600
     ggcatcgtcc gcaagatcct gttcgtgccg ccgtcgatgc tggcgtccga cctgttgcgc       660
     cgcatgcagg tgaaccgcac gcagatggcg ctcgtcatcg acgaatatgg cggcaccgac       720
     gggctggcct cacatgaaga tatcgtcgaa atggtggtcg gcgacatcga tgacgaacat       780
     gacgacgaag aggtgatgtt caagcgcgtc gccgaggaca tgttcatcgc cgacgcccgc       840
     gtcgagctcg aagagatcgc ccaagcgatc gggccggatt tcgacatcag cgagcaggtc       900
     gacgaggtcg atacgctggg cggcctgatc ttctcagcac ttggccgcat cccggtgcgc       960
     ggcgaggtcg tccaggcgct gccgggcttc gaattccaca tcctcgacgc cgatccccgc      1020
     cgcatcaagc ggctgcgcat cacccgcaag cgccacgcga tccgccgtcg cgccaaggcg      1080
     gatggtgacg cagctcccgg cgacgaccgg ccggcggaat cgaccgccaa ctga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page