(data stored in ACNUC7421 zone)

EMBL: CP001622.PE270

CP001622.PE270       Location/Qualifiers
FT   CDS_pept        282071..282691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0271"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: ret:RHE_CH00585 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54582"
FT                   /db_xref="GOA:C6B0G3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G3"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACS54582.1"
FT                   /translation="MALKYKLILASGSPRRVDLLNQAGIEPSRLMPMDIDEAPKKSEHP
FT                   RSLARRLSAEKAEAALAAIKGDITWKGSYILSADTVVAVGRRILGKAEFADEALSSLHL
FT                   LSGRNHMVYTGVCLVTPDRKIRQKIVETKVRFKRLSGFEIENYLASGQWRGKAGAYGIQ
FT                   GLAGTFVQKMVGSYTNVVGLPLYETILLLTGEGFDVHSRWPEG"
     atggcgctga aatacaagct cattctggcc tcgggctcgc cccgtcgcgt tgacctgctc        60
     aaccaggccg gcatcgagcc ctcgcgcctg atgccgatgg atatcgacga ggcgccgaag       120
     aaatcggagc atccgcgttc gcttgcccgc aggctttcgg ctgagaaggc cgaagccgcc       180
     cttgccgcca tcaagggcga tatcacctgg aagggcagct atatcctgtc tgccgatacg       240
     gtggtcgccg ttggccggcg cattctcggc aaggctgagt tcgccgacga ggcgctgagt       300
     tcgctgcatc tcctctcggg acgcaaccat atggtctaca ccggcgtttg cctggtgacg       360
     ccggatcgca agatccgtca gaagatcgtc gagaccaagg tccgcttcaa gcgtctctcc       420
     ggtttcgaga tcgagaacta cctggcctcc ggccagtggc gcggcaaggc aggcgcctac       480
     ggcatccagg gcctcgccgg caccttcgtg cagaagatgg tgggctccta caccaatgtc       540
     gtaggcctgc cgctttatga aaccattctg cttttgaccg gcgaaggctt cgatgtgcat       600
     agccggtggc ccgagggctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page