(data stored in ACNUC7421 zone)

EMBL: CP001622.PE271

CP001622.PE271       Location/Qualifiers
FT   CDS_pept        282827..283039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0272"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   rec:RHECIAT_CH0000661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54583"
FT                   /db_xref="GOA:C6B0G4"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G4"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ACS54583.1"
FT                   /translation="MPEDKKAAAKVEPLRKTRPCPECGKPSHREHYPFCSNRCREADLS
FT                   RWLTGAYAIPVADDETKADYPDEEN"
     atgcctgaag acaagaaagc ggccgccaag gtcgaaccgc tgcgcaagac gcgcccttgc        60
     cccgaatgcg gcaaaccctc ccaccgcgaa cattacccct tctgctccaa ccgctgccgg       120
     gaggccgatc tctcccgctg gctgaccggc gcctatgcca ttccggttgc cgacgatgag       180
     acgaaggctg attatccgga tgaagaaaat taa                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page