(data stored in ACNUC7421 zone)

EMBL: CP001622.PE272

CP001622.PE272       Location/Qualifiers
FT   CDS_pept        283679..284026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0273"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: sme:SMc00089
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54584"
FT                   /db_xref="GOA:C6B0G5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS54584.1"
FT                   /translation="MGEIQKLTIDGKGYVLLSEDDYQDLVDVSDARAAKARIDAGEETW
FT                   PEDVVKALIAGEDPVRVFRKHRGMSIKELAEKSGLSQPYLSEIETGKKEGSLDALRSIA
FT                   SALDVDLDDVA"
     atgggtgaaa tccagaaact gaccatcgac ggcaaggggt acgtgctgct ttccgaagac        60
     gactatcagg accttgtcga cgtcagcgac gcgcgtgccg caaaggcgcg tatcgacgct       120
     ggcgaagaga cctggcctga agacgtcgtc aaggcgctga tcgctggcga agatcctgtc       180
     cgggtgttcc gtaagcatcg cggcatgagt atcaaggagc tggctgaaaa gtccggcctc       240
     tcccagccct acctttccga aatcgagacc ggaaagaagg agggctccct ggacgcactc       300
     aggtcgatcg ccagcgcgct ggacgtcgac cttgacgatg tggcttga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page