(data stored in ACNUC7421 zone)

EMBL: CP001622.PE273

CP001622.PE273       Location/Qualifiers
FT   CDS_pept        complement(284185..284463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0274"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   gdj:Gdia_2654 transposase IS3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54585"
FT                   /db_xref="GOA:C6B0G6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G6"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS54585.1"
FT                   /translation="MGKRKFDDDQITGILKEHQAGVTVADVCHKHGISEPTFYRWQSLQ
FT                   FGNVGLHAKRLRALEEENQKLKKLLAESMLSAATLSEMLAKTLKGRH"
     atgggcaagc gaaaattcga cgacgaccag attacgggta ttctgaagga gcaccaagcc        60
     ggagtgacag tggcagatgt ttgccacaag cacggtatca gcgagccgac cttctatcgg       120
     tggcaatccc tgcagttcgg gaatgtcggt ctccatgcca aaaggttgag agcactggag       180
     gaagagaacc agaagctcaa gaagcttttg gccgaatcca tgctctcggc ggcaacactg       240
     agcgagatgc tggcgaagac attgaaaggg cgacactaa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page