(data stored in ACNUC7421 zone)

EMBL: CP001622.PE274

CP001622.PE274       Location/Qualifiers
FT   CDS_pept        complement(284471..285916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0275"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: rec:RHECIAT_CH0000667 putative protein secretion
FT                   protein, HlyD family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54586"
FT                   /db_xref="GOA:C6B0G7"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G7"
FT                   /inference="protein motif:TFAM:TIGR01843"
FT                   /protein_id="ACS54586.1"
FT                   /translation="MALVQLDATPAKFSNSSRTSQQLVPRSTATARQQTAYLPVIESKQ
FT                   RGPAPPSPMPGLRGVVWTGNLLILVFIVGLGIWSVLAPLKSAAIASGVVEPESSRKTIQ
FT                   HLEGGIVRRILVKNGDAVMGGQIVIELDDTKSRSERDSIQGQLWDAEGSRARLLAEQTG
FT                   GDHIAYPEDLRAAMDKYPSVSTILIGQQKIFEARRRVMQAEIQIANEKIAQVRQEIVGL
FT                   GAQKAALADRATISSQELDQVTILSAKGLERRSRLLNLQREKADLDGQQGQVEAQISRA
FT                   YQVISGSQADLAKLESDRLSEVAQGMRDTESRIMQLRERLRAIDDQLSRTDIRAPEDGT
FT                   IMNLRIHTSGGVIGAGEPLVDLLPRSDRLVVSAHVRPEDINLVHAGLEAQVHLLPYNQR
FT                   RVPLLKGRVEYVSADRLTDPQSGQPYFAATIRVTDERLAKMKDVELVAGMPAQILIETG
FT                   KSSVALYAVRPLLDSFNRAFRED"
     atggcccttg ttcaactgga cgcaacgccg gcgaaatttt caaattcgtc aaggacgagt        60
     cagcagttgg ttccacgatc gacagcgacg gccaggcaac agacggccta tttgccggtg       120
     atcgagtcga aacagcgcgg acccgccccc ccttcgccca tgcccgggct cagaggtgtt       180
     gtctggacgg ggaacctgtt gatcctggtc ttcatcgtcg gattgggaat ctggtcggtc       240
     ctggcgccgc tgaaaagcgc tgcgatcgca tccggcgttg tcgaaccgga gtccagccgc       300
     aagaccattc agcatctgga aggcgggatt gtccgacgga tactcgttaa aaacggcgat       360
     gcggtcatgg gcgggcaaat cgtgatagag ctcgacgata cgaagtcccg ctcggagcgc       420
     gacagcattc aagggcaact ttgggacgcc gaaggaagcc gcgcccgcct gcttgcggag       480
     cagacgggcg gcgaccatat cgcctatcct gaggatctca gggcagcaat ggacaaatat       540
     ccttcggtca gcacaattct gattgggcaa cagaaaatct tcgaagcccg tcgccgggtc       600
     atgcaggccg aaattcagat cgccaatgaa aagatcgcgc aggtgcggca ggaaatcgtc       660
     ggacttggcg cgcagaaggc agcactggcc gacagagcga caatctcgag ccaagaactg       720
     gatcaggtta cgatcctcag cgccaaaggt ctggaaagaa gaagcagact tctcaacctc       780
     cagcgggaaa aagcagacct tgatggccag cagggtcaag tcgaggcaca gatctctcgc       840
     gcctaccagg tgatcagcgg gtcacaggcc gatctcgcaa agcttgagag cgaccggttg       900
     agcgaagtcg cccagggcat gcgcgatacg gagagccgga tcatgcaact gcgcgagcgt       960
     ttgcgggcga tcgacgacca actctcaagg accgatatcc gtgctcccga agatggaaca      1020
     atcatgaacc tgcgcatcca cacatcaggt ggggtgatcg gcgcgggtga accgctcgtc      1080
     gatcttctgc cgcgctcaga tcgccttgtc gtgtctgccc acgtcagacc ggaagacatc      1140
     aatctcgtcc atgccgggct cgaggcacag gtccacctcc ttccatataa tcagcggcgc      1200
     gttccactcc tgaaaggtcg agtggagtat gtatcagcgg accgcctcac cgatccgcag      1260
     agcggccagc cctactttgc cgcgacgatc cgtgtaacgg acgagcggtt ggcgaaaatg      1320
     aaagatgtcg agctggtcgc gggcatgccc gcacagatac tgatcgaaac gggcaaaagc      1380
     agcgtggcgc tctatgccgt cagaccactc ctcgacagtt tcaacagagc atttcgcgag      1440
     gactga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page