(data stored in ACNUC7421 zone)

EMBL: CP001622.PE275

CP001622.PE275       Location/Qualifiers
FT   CDS_pept        complement(285931..287646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0276"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: rec:RHECIAT_CH0000668 putative protein ABC
FT                   transporter protein; TIGRFAM: type I secretion system
FT                   ATPase; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54587"
FT                   /db_xref="GOA:C6B0G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G8"
FT                   /inference="protein motif:TFAM:TIGR01842"
FT                   /protein_id="ACS54587.1"
FT                   /translation="MTTISIKPPRPPTQLVVALRACAGAFGLVFLYSCGYNLFLLAPSI
FT                   YLLQIYDRVLSSRSADTLLMLTMIIAIGVMVGSTLDIVRRAALSRIGSWLDHRLRPMVL
FT                   TASFEYAARADTGAATECYRDLAALRQFLDSPASSLFFDVPWAPVFLFLLFLVHPLLGT
FT                   IGLLSALALLLFAFLTELATREPLAYANLALSRSYIRFATALKNIEVIRAMGMQDGAAL
FT                   IVYRDAEMARRAQDIAMHRTEIILGFSKSIRTLAQILMMGSATWLVLANNGSAGIIFVA
FT                   SLLLGRGLAPIEGAIGAWRSFTFARNAFNRLNRMLISVASEHDARMVPLPEPNGLVLDN
FT                   VSYIKPFADRPILTGITLRLAPGDCIALIGPSGSGKSTLGRVIAGVVQATSGCALLGGV
FT                   DISALRLCGGTRHVGYLPQDIELFGGAIKDVIGRLDGGDPGKAIDAAKLVGLHDAIMRL
FT                   PQGYETDIGEGGNLLLRAQRQQLGLARAAYGNPSLIVLDDPNSSLDYDGERMLFTAIER
FT                   MKSRGMTVVIMTHRMGILPVTNKIAIMRNGTVAAFGDSERIYETYLQPPSRTGT"
     atgacaacaa tttccataaa gccaccgcgc ccgccgacac agcttgttgt tgcgctccgg        60
     gcttgtgccg gagccttcgg gctggtcttc ctctatagct gcggctacaa tctgtttctt       120
     ctcgcgcctt cgatctatct cctgcagatc tatgacaggg tcctgtcgag ccgaagcgct       180
     gacacgctgc tgatgctgac gatgatcatc gccatcggcg tgatggtcgg atccacgctg       240
     gatatcgtgc gcagagcagc tctttcgcgc atcggcagtt ggctggacca ccggctgcgg       300
     cccatggtgc tgacggcatc gttcgaatat gccgctcgcg ccgatacggg agccgccacg       360
     gaatgctaca gggacctggc cgcactacgc cagttcctcg attcaccggc tagctcgctc       420
     ttttttgatg ttccctgggc accggtattc ctgttcctgc tctttcttgt tcatccgttg       480
     cttgggacca tcggtcttct gagcgcgctt gcacttctgc tgtttgcgtt cctgacggaa       540
     ctggcgacga gagagccgct tgcctacgcc aatcttgccc tttcgaggag ctatatccgg       600
     tttgcgaccg ccctcaaaaa catcgaggtg atccgggcaa tgggcatgca ggatggcgca       660
     gcgctgatcg tctatcgcga tgcggaaatg gcaagaaggg cgcaggacat cgcgatgcat       720
     cggacggaga tcattcttgg tttctccaaa tcgatccgca ccctcgcgca gatcctgatg       780
     atgggatccg ccacctggct ggtgctcgca aacaatggca gtgccgggat catcttcgtt       840
     gcgagcctgc tgctcggacg cgggcttgca ccaatcgagg gcgcaatagg tgcatggcgc       900
     tcctttacgt ttgcgcgcaa tgccttcaat cgcttgaaca gaatgctgat atcagttgca       960
     tctgaacacg atgctcgaat ggtgccgtta ccggaaccca atggcctcgt tctcgataat      1020
     gtcagctata tcaagccatt cgccgatcgg ccgatattga caggcatcac cttgcgcctc      1080
     gcgcccggcg attgcatagc gctcatcggt ccttcgggat cgggaaaatc gacactcggt      1140
     cgcgtcatag caggcgttgt gcaagcaacg agcggatgtg ctcttctcgg cggggtcgat      1200
     atctcagctc tgcgcctttg cggggggacc cgccacgtcg gatacctgcc gcaggacatc      1260
     gaacttttcg gcggggcgat caaggatgtg atcggccggc tggacggagg agatcccggc      1320
     aaggcgatcg acgccgcaaa gctggttggc ttgcacgacg cgatcatgcg gctgccccag      1380
     ggctacgaga ccgatatcgg tgaaggtgga aacctgctcc ttcgagcgca acgccaacag      1440
     ttgggactgg cacgggcggc ctatggaaat ccgtccctga tcgttctcga cgatccgaat      1500
     tcgagcctgg attatgacgg cgaacgcatg ctgttcacgg caatcgagcg tatgaaatcc      1560
     agggggatga ccgtcgttat catgactcac cggatgggga tcctgccggt caccaacaag      1620
     attgccatca tgcgtaacgg gacggtggca gccttcggcg acagcgagcg gatttatgaa      1680
     acttatcttc agccaccgtc tcgaacagga acatag                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page