(data stored in ACNUC7421 zone)

EMBL: CP001622.PE276

CP001622.PE276       Location/Qualifiers
FT   CDS_pept        complement(287737..288312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54588"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0G9"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000669"
FT                   /protein_id="ACS54588.1"
FT                   /translation="MPIPQISDTIHLNNPDAGDANAGNGGDGHNDGNINYNPVAYVDPV
FT                   QTVYGADTHLHNGDHVWQKAGWDAGSGGDGGFAQAKNGFLAAVTNSGDGGAGGDSHSNG
FT                   SQGNSSGGDTATVNAATTATQYTQLVADQHATILAGVGGNGGNGNNALGGDISSALVHT
FT                   DPETTTVNNSLDHFINAFGHIDVDHLGS"
     atgcctattc cacagatatc cgacacgatt catctcaaca acccggatgc gggtgacgcg        60
     aatgccggca acggcggcga tggccacaac gatgggaaca tcaactacaa cccggttgca       120
     tatgtagacc cagtgcaaac ggtctacggg gccgataccc atctgcacaa cggcgatcac       180
     gtttggcaga aggcaggttg ggacgccggc agtggcggag acggtggctt tgctcaggcc       240
     aagaacggct tcctggcggc ggtcacgaac agcggcgacg gcggcgcggg gggagattcc       300
     cactccaacg gcagccaagg aaactcgagc ggcggcgaca cggctaccgt gaatgcggcg       360
     acgaccgcga cacaatatac gcagcttgtg gccgatcagc atgcgaccat cctcgcaggc       420
     gtcggcggca acggcggcaa cggaaacaac gctctgggcg gcgatatctc gtcagctctg       480
     gttcacacgg atcccgaaac gacgacggtg aacaattctc tcgatcactt cataaacgcc       540
     ttcggccata tcgacgtcga ccatctcggc tcctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page