(data stored in ACNUC7421 zone)

EMBL: CP001622.PE277

CP001622.PE277       Location/Qualifiers
FT   CDS_pept        288902..289996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54589"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H0"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000670"
FT                   /protein_id="ACS54589.1"
FT                   /translation="MAETRSLVEDLPKAGTDQHLASNLAAGHLALVPTWLPLDVASGPS
FT                   SNSAGSGGDGISEGVISSNALAVFMPSNAAIAGPHSGADAFQGNDALINQHPTEMAGIG
FT                   GNGGSGNVAIGSGDGANHAGTGGNGLFYGGLVSTEVALFAPVNTAVAAGPGATAHAEQS
FT                   NNALFLQGATQIGGMGGSGGDHNVASHGSSMSPGTALTLTGDFYAGHGGDGYFVGTMVD
FT                   VSIAIFSPINIAIGAAGGSAEAHQTNNVIFDQGAVQIAGIGGNGGGFNLSSDTIFTGNH
FT                   ALGGGGDGVGSSTGSMVDVNFGYFHPINIAVPAGGTADAQQVDHVLYDQHALQLAGIAG
FT                   HGGDGNLTDAHSALVDDILSFMHG"
     atggcggaaa ctcgttcctt agtggaagac ttgcccaagg cgggcaccga tcaacacctc        60
     gcctccaatc tggccgcggg acatctggcg ctggtgccga cttggcttcc attggatgtc       120
     gcttccggtc caagctctaa ttcagccggc agcggtggtg acgggataag cgaaggcgtg       180
     atcagcagca acgcgttggc cgttttcatg ccgtccaatg ccgctattgc gggacctcat       240
     tcgggtgccg acgctttcca gggcaatgat gcgctcatca atcagcatcc caccgaaatg       300
     gccgggatag gcgggaatgg cggcagcggc aatgttgcca tcggcagcgg cgatggcgcc       360
     aatcatgccg gcacgggggg caatgggctt ttctacggcg gactcgtgag caccgaagtc       420
     gcactgtttg cccccgtcaa tactgccgtg gctgcaggcc ccggcgcgac ggctcacgcc       480
     gagcaatcga acaacgccct gttcctgcag ggcgcaaccc agatcggcgg catgggcggc       540
     tcgggcggag accataacgt cgcgagccac ggctcgtcga tgagcccggg aactgcgctc       600
     acattgaccg gcgactttta tgcaggtcat ggcggcgatg gatatttcgt cggcactatg       660
     gtcgacgtga gtatcgccat cttctcgccg atcaatatcg ccattggcgc cgcgggcggc       720
     tcggcggagg cccatcagac aaacaatgtc attttcgatc agggcgctgt gcagatcgca       780
     ggcatcggcg gcaatggcgg tggcttcaac ctgtcgtcag acacgatttt caccggcaac       840
     catgcgctcg gcggtggcgg tgacggggtc ggatcgtcaa ccggcagcat ggtcgatgtc       900
     aatttcggct atttccatcc catcaacatt gccgttcccg ccggtgggac ggcggacgcc       960
     caacaggtcg atcatgttct ctatgatcaa catgcgctcc agttggccgg catcgcgggc      1020
     cacggcggag acggtaacct cacagacgcc cattcggctc tcgtagacga cattctgagc      1080
     ttcatgcatg gctag                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page