(data stored in ACNUC7421 zone)

EMBL: CP001622.PE278

CP001622.PE278       Location/Qualifiers
FT   CDS_pept        complement(290404..290673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54590"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54590.1"
FT                   /translation="MNACWFDLSLQTFQPSPNSRTASGSTKLSKALKRQLICYRSISES
FT                   AIGYNELPIGSALFSYLNSKQSQTRQQNDKREKQQKLEIADYPL"
     atgaatgcct gctggttcga cttgtcgctg cagactttcc agccttcgcc gaattcacgt        60
     acggcaagcg ggtcaacaaa gctttcaaag gcactgaaaa ggcaactgat ctgctaccga       120
     tccatttcgg aaagcgccat tggatataac gagttgccga tcggctcggc tttgttttca       180
     tatctcaatt caaagcagtc gcagacccga caacaaaatg acaaacgcga aaagcaacaa       240
     aagcttgaga tcgctgacta ccccttatga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page