(data stored in ACNUC7421 zone)

EMBL: CP001622.PE279

CP001622.PE279       Location/Qualifiers
FT   CDS_pept        290862..291599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0280"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: rec:RHECIAT_CH0000671 putative
FT                   transcriptional regulator protein, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54591"
FT                   /db_xref="GOA:C6B0H2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H2"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS54591.1"
FT                   /translation="MSDITGTRRRIGRNAPTVIIIEHSTLARTTVVKLLERELAGWNVI
FT                   DLISTESLESALGAEVRLIVLGLAGRSVESTSLRDDLAAIAARFPEAPVTLLSGTDDAI
FT                   IARQALKMGLRGLFSTSLPIDIALAGLRLVLAGGTFFPQLLGAVTAVPNDHTPVRNEAE
FT                   KSLDERTQYLAIADFTPREADVLAELQCGCSNKVIAGKLNLSGHTVKMHLQHIMRKLQA
FT                   QNRTEVVARLIQRAAGGPDVSPS"
     gtgtccgaca ttactggaac taggcgccgt atcgggcgca atgcaccaac tgtgatcatc        60
     atcgagcatt ctacattggc gcgcaccacc gtggtgaagc ttcttgagcg tgaactcgcc       120
     ggatggaacg ttatagattt gatctcgacc gagagtctcg agagtgctct cggagctgag       180
     gtgcgtttga ttgtattggg tctggctggc agaagtgttg agagcaccag cctgcgtgac       240
     gatctcgcgg cgattgctgc acgttttcct gaggctcctg tcacgttgct ctcaggtacg       300
     gatgacgcca tcatagcccg tcaggcactc aagatgggcc tccgcggctt attctcgact       360
     tcacttccca ttgacattgc ccttgccggt cttcgtctcg ttctggctgg aggaacgttt       420
     ttcccgcagc tattgggagc tgttacagca gtcccaaacg atcatacgcc ggtcagaaat       480
     gaggccgaaa agagtttgga tgagaggacg cagtatttgg cgattgctga tttcactccc       540
     cgggaagcgg atgtcctcgc agagctgcaa tgcggctgtt caaataaggt cattgcagga       600
     aaacttaatt tgtcggggca tacggtgaag atgcatttgc agcacataat gcgcaagttg       660
     caggcgcaga accgcacaga agtggttgcc cgcttaattc aaagagccgc cggtgggcct       720
     gacgtctcgc cgagttag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page