(data stored in ACNUC7421 zone)

EMBL: CP001622.PE28

CP001622.PE28        Location/Qualifiers
FT   CDS_pept        complement(26907..27422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0029"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rec:RHECIAT_CH0000414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54340"
FT                   /db_xref="GOA:C6AYB6"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB6"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACS54340.1"
FT                   /translation="MAELDIQISVEDIGWPGEETLLSFCERVLGAAVVYLSDSEKQPFP
FT                   TLPPEVSLVFTDDASIQDINAEWRGKDKATNVLSFPAFPVQPGKMPGPMLGDIIIARET
FT                   LEREAAELEKSFDDHLTHLLVHGFLHLLGYDHMNSAEAEIMEGLETRILAQLGLSDPYE
FT                   GQDLKMEP"
     atggccgaac tcgacatcca gatcagcgtc gaggacatcg gctggcccgg cgaggagacg        60
     ctgctgtcgt tttgcgaacg cgtgctcggc gcagcagtgg tctatctcag cgacagcgag       120
     aagcagccct tcccgacgtt gccgcccgag gtttcgcttg ttttcaccga cgatgcctcg       180
     atccaggaca tcaatgcgga atggcgcggc aaggacaagg cgaccaacgt gctctccttt       240
     ccggcctttc cggttcagcc cggcaagatg cccggcccga tgctcggcga catcatcatc       300
     gcccgggaga cgctggagcg ggaagcggcc gagctcgaaa agagtttcga cgaccacctg       360
     acccatcttc tggtgcacgg tttcttgcat cttctcggct acgaccatat gaatagtgcc       420
     gaagccgaaa ttatggaggg gctggagact cgcattttgg cccagctcgg cctatctgat       480
     ccctacgagg gtcaagacct taaaatggaa ccatga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page