(data stored in ACNUC7421 zone)

EMBL: CP001622.PE280

CP001622.PE280       Location/Qualifiers
FT   CDS_pept        291725..291976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54592"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54592.1"
FT                   /translation="MRKRKAIVEAALESEYERQALGIMNTEQALKLEDSDGLVFSHPDK
FT                   EAGVTDHFVDQDELRRLVRRSTPPLSRLQSQPRTTRSS"
     atgcgcaaga gaaaagccat cgtcgaggcg gcgctcgagt ccgagtacga gcgccaggca        60
     ctggggatca tgaataccga gcaagctctc aagcttgagg attccgacgg tcttgtcttc       120
     agtcatccgg ataaagaggc cggagtgacg gaccattttg tcgatcaaga tgagctgcgc       180
     cgattggtgc ggcggtcaac gccgccgctt tcccgattgc aatcgcagcc tcgtacgacg       240
     cgttcgtcct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page