(data stored in ACNUC7421 zone)

EMBL: CP001622.PE281

CP001622.PE281       Location/Qualifiers
FT   CDS_pept        complement(291980..292705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0282"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54593"
FT                   /db_xref="GOA:C6B0H4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54593.1"
FT                   /translation="MEFRGKTVIVTGAGKGIGREIVRMLVERSAQVVALTRSAADVEAL
FT                   RGEFGCRAIQVDLADADATREAAIAALPADFLINCAGTTELQPFLETTVEAFDRLVAVN
FT                   TRAPMIVAQEYARSLIKEGRKGAIVNVSSVASFVGIPDHAAYCASKGGLDGLTRVMAKE
FT                   LAPHGIRANGVHPTVTLTPMAVKAWSDPEKAAGMMKRIPVGRFAEPADIAEVVLFLLSD
FT                   QAAMVNGISMPVDGGYMIA"
     atggagttca gaggaaagac ggtgatcgtg accggcgccg gcaaaggtat cggacgcgaa        60
     attgtaagga tgctcgtcga acggagtgcg caggtcgtcg cgctgacgcg tagtgctgcc       120
     gacgtcgaag cgttgcgagg ggaattcggc tgccgggcaa tccaggtcga tctcgcggac       180
     gccgatgcaa ccagagaggc ggcgatcgct gcccttcccg cagatttcct tatcaactgc       240
     gccggcacga ccgagctcca gccgttcctg gagacgaccg tcgaagcgtt cgatcgtctt       300
     gtcgcggtca atacgcgcgc tccgatgatc gtcgcccagg aatatgcccg ttcgctgatc       360
     aaggagggcc gcaagggcgc catcgtcaat gtctcgtcgg tcgcctcctt cgtcggcatc       420
     cccgaccacg cggcctattg tgcatcgaag ggtggattgg atggcttgac gcgggtcatg       480
     gccaaggaac ttgcgccgca cggcatccgc gccaacggcg tccatccaac ggtgacgttg       540
     acgccaatgg cggtgaaggc atggagcgat cccgagaaag ccgcggggat gatgaagcga       600
     attcccgtcg gtcgcttcgc cgagccggca gatatcgccg aggttgttct tttcctgctg       660
     tccgatcagg ctgccatggt gaacgggata tcgatgccgg tggacggtgg ttatatgatt       720
     gcttga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page