(data stored in ACNUC7421 zone)

EMBL: CP001622.PE282

CP001622.PE282       Location/Qualifiers
FT   CDS_pept        complement(292717..293778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0283"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG:
FT                   rsq:Rsph17025_3579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54594"
FT                   /db_xref="GOA:C6B0H5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54594.1"
FT                   /translation="MANVQVSDVTKKYGSLQVMHGVSVDIEDGEFVVLVGPSGCGKSTL
FT                   LRMIAGLETVSSGDIRIGGRVVTDAPPKERDIAMVFQSYALYPHKTVAENMGFPLKMAK
FT                   RPKAEIDEKVGRAAEILDLTRYLDRYPKQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVTMRVEIKELHQRLKTTTVYVTHDQIEAMTMANKIVVMRDGRVEQIGKPLDLY
FT                   DFPVNLFVAGFIGSPSMNFLEGRIATRDGRKIVVTEQGITLPMADTNAEEGRAVTYGIR
FT                   PEHITIGEEGVPVEVSVFEPTGSETLIFGRTGGVPIDALIRERIEVDPGRTMYFHIDPR
FT                   RAHIFDRETGQRL"
     ttggcaaacg tacaggttag cgacgtcacc aagaagtatg gctctcttca ggtcatgcat        60
     ggcgtgagcg tcgacatcga ggacggggaa ttcgtcgttc tggtcggtcc ctccggatgc       120
     ggcaagtcca ccctgctccg gatgatcgcc gggctggaga cggtcagcag cggagacatc       180
     cggatcggcg gccgtgtcgt caccgacgct cctccaaagg agcgtgacat cgcgatggtc       240
     ttccagagct acgcgctcta tccccacaag acggtcgccg agaatatggg ctttccgctg       300
     aagatggcca aacgtccgaa ggcggagatc gacgagaagg tcggcagggc ggccgagatc       360
     ctcgatctga cgcgttatct cgaccgctat ccgaagcaac tgtcgggcgg acagcgtcaa       420
     cgcgtggcga tgggtcgtgc catcgtccga gacccgaagg tcttcctatt cgacgagcca       480
     ttgtcgaacc tcgacgctaa actccgcgtc accatgcgcg tcgagatcaa ggagcttcac       540
     cagcggctga agaccaccac cgtctacgtc acgcacgatc agatcgaggc gatgacgatg       600
     gccaacaaga tcgtggtgat gcgtgacggg agggtcgagc agatcggcaa gcctctcgat       660
     ctctacgact tccccgtcaa cctcttcgtc gccggcttca tcggcagccc atcgatgaac       720
     ttccttgagg gccgcatagc cacccgcgac ggcaggaaga tcgtcgtcac cgaacagggc       780
     atcaccttgc ccatggcaga tacaaatgcg gaggaaggac gagccgttac ctacggcatc       840
     cgaccggagc acatcacgat cggcgaagaa ggcgttccgg tcgaagtctc ggtgttcgag       900
     ccgacgggtt ccgagacgtt gatcttcggc cgcacgggag gcgtgccgat cgacgcgctg       960
     atccgtgagc gtatcgaggt cgaccccgga cggacgatgt acttccacat cgatccccga      1020
     cgtgcgcata tcttcgatcg ggaaacaggc cagagacttt ag                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page