(data stored in ACNUC7421 zone)

EMBL: CP001622.PE283

CP001622.PE283       Location/Qualifiers
FT   CDS_pept        complement(293839..294045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54595"
FT                   /db_xref="GOA:C6B0H6"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H6"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_3581"
FT                   /protein_id="ACS54595.1"
FT                   /translation="MTSQSRNNERKPGFLPIETNWFDRLFISIVIWVALSLFWMRFIEP
FT                   FGPSVWFAAAISAVLGAYVVWKG"
     atgacgtctc aatcaagaaa taacgaacgc aagccgggat ttctgccgat cgaaacgaac        60
     tggttcgacc ggctcttcat ctcgatcgtg atctgggtcg cgctctcgct gttctggatg       120
     cggttcatcg agccgttcgg gccttcggta tggttcgcgg cggcaatctc ggcggtcctt       180
     ggcgcctatg tcgtctggaa gggatga                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page