(data stored in ACNUC7421 zone)

EMBL: CP001622.PE284

CP001622.PE284       Location/Qualifiers
FT   CDS_pept        complement(294050..294889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsq:Rsph17025_3582
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54596"
FT                   /db_xref="GOA:C6B0H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54596.1"
FT                   /translation="MKKTRFPWLPVVLWTLISLATLFPIYWLFVISVKQPFDLFSTPDV
FT                   ILRSFFWKNYQDVLTNPTLRGYMLNSMIISSGNALLVTTLGFLACYALTRFDLAGKESI
FT                   FFWTITNRMAPPAVFLLPLFLLLTQVYRIGDFSLADSKLGMILVYCSFNLPFAIWTLRP
FT                   TVEGIPKELDEAAYMDGASPWTVLYDIIFPLARPGLAVTLILTWVFAWNEYLLAATLTN
FT                   FHARTLTTGLSEYVTTTGTAWGIMAAISMLTLVPALIVFSVVQRHIVAGLTFGAVKG"
     atgaagaaga cccgttttcc ctggcttccg gtcgtcctgt ggaccttgat aagcctcgcg        60
     acccttttcc cgatctactg gctcttcgtc atatcggtga aacagccctt cgacctgttc       120
     tcgacgcccg atgtcattct ccggagcttc ttctggaaga actaccagga cgtgctgacc       180
     aatccgacct tgcgcggata catgctcaac tcgatgatca tttcgtcagg caacgcgctg       240
     ctcgtcacca cgctcggctt ccttgcctgc tacgccctga cgcgcttcga cctcgccggc       300
     aaggaaagca tcttcttctg gacgatcacc aaccgcatgg cgccgccggc ggtcttcctg       360
     ctgccgcttt tcctgctgct gacgcaggtc tacaggatcg gcgacttctc gctcgccgat       420
     tccaagctgg gcatgatcct ggtctattgc tccttcaacc ttcccttcgc catctggacg       480
     ctgcgtccga ccgtggaagg cattccgaag gaattggacg aggcggccta catggacggc       540
     gcgagcccat ggaccgtcct ctatgatatc atctttcctt tggcacggcc cggacttgcg       600
     gtgacgctaa tcctgacctg ggtgtttgcg tggaacgaat acctgctggc agcgacgctc       660
     accaatttcc acgcgcggac tctgaccacc ggcttgtctg aatatgtgac gacgacggga       720
     acggcctggg gcatcatggc cgcgatctca atgctgacat tggttccggc gctcatcgtc       780
     ttttcggtgg tccagcgtca catcgtcgcc ggcctgacct tcggcgccgt gaaaggatga       840
//

If you have problems or comments...

PBIL Back to PBIL home page