(data stored in ACNUC7421 zone)

EMBL: CP001622.PE285

CP001622.PE285       Location/Qualifiers
FT   CDS_pept        complement(294894..295769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0286"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54597"
FT                   /db_xref="GOA:C6B0H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54597.1"
FT                   /translation="MHSQKLGWLLLSPTIVILGLFGIFPFIYVLWVSFHSWNPFAANPG
FT                   MIFNWAENYRRLVFDPQFLASLGITLTFVFFAVVSELVLGYILAQALLKDFPGKAVFRT
FT                   IHTLPLIMAPIIVGSVWKLMTTPSIGIIPYLLRSWFGYDLNIGQSAVAAFTVTVIMDIW
FT                   HWTPLVTLSLIAALVSLPSDPFEQAQIDGAGKSQIFWHITLPLIRPAMLATVFIRLMDA
FT                   LRTVDEVLMLTGGGPGSSTRYIGVHIFKEVFPKTNYGYGSAISVIVLYLTIVVCWLLYV
FT                   GLIAPRVKRG"
     atgcattcgc agaagctcgg gtggctgttg ctgtcaccga ccatagtgat cctcggactg        60
     ttcgggatct ttcctttcat ctacgtcctc tgggtctctt tccattcatg gaacccgttc       120
     gcggccaatc cgggcatgat tttcaactgg gctgagaact atcggcggct cgtcttcgac       180
     ccgcagttcc tggcatcact cggcatcacc ctgacattcg tcttcttcgc ggtcgtgtcg       240
     gagctggtcc ttggctacat cctcgcccag gcgctgctca aggactttcc cggaaaagcg       300
     gtgtttcgca cgatccatac gctgccgctg atcatggcgc cgatcatcgt cggctcagtc       360
     tggaagctga tgaccacccc ctccatcggc atcattccct atcttctgag gagctggttc       420
     ggctacgatc tgaatatcgg ccagagcgcc gtcgcggcct tcaccgtcac tgtcatcatg       480
     gacatctggc actggacgcc gctcgtcacc ctgtcgctga tcgccgcact cgtctcactt       540
     ccttcagacc cgttcgagca ggcgcagatc gacggcgcgg gcaaaagcca gatcttctgg       600
     cacatcacgc tgcccctgat ccgtccggcc atgctcgcca ccgtgttcat caggctgatg       660
     gatgcgctgc gcaccgttga cgaagtcctg atgctgaccg gcggcggtcc gggttcatcg       720
     acgcgctaca tcggcgtcca tatcttcaag gaagtctttc ccaagacgaa ttacggctac       780
     ggttcggcga tctccgtcat cgtcctctat ctcaccatcg tcgtctgctg gctgctctac       840
     gtcggtttga ttgcgccccg cgtgaagaga ggttga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page