(data stored in ACNUC7421 zone)

EMBL: CP001622.PE286

CP001622.PE286       Location/Qualifiers
FT   CDS_pept        complement(295867..297300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0287"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54598"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0H9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54598.1"
FT                   /translation="MNYALKASALALTLSLAATASPAWADFWSDAGAKFKGVTLHGVTE
FT                   STPPSNYIRNVLAPEFEKKTGIKVDIETTSWDQMYDKAIKDMEAKTGIYDMVYIEQDII
FT                   YSYLARNFLVDITKTLKDQPDLKAPTYDDANFTSFADYFKDASGDLFGVPMEAFLKAYL
FT                   YRKDLFEDPKIKEAFKKETGKDLKPATTHAEYTEIAEFFTKYGKDNGMELWGTTAQAHT
FT                   GHPASWYEFFESIAPTFGVYNWGIDAKNNYAATVEHGGAMNGDKAKAALKYWLHLRDIA
FT                   PPESTQSTWTETATTFAAGRVAQGLIYGENAAWIASDPAQSKVVGQVGFALPPLEPGVL
FT                   DDAKAGKGYIGYYDGGAFGVPVTSKNKEASLLFLEFIGQNEVQPDWAIAAPRITNKATF
FT                   DDPKVKEMDVKLGGFYTMLKDDGKLFAGAPPYPFHAQVREATAPIFYDILTGKIGPDEG
FT                   LDQMAAKAEEELTSLGYRK"
     atgaactatg ctttgaaggc tagcgcgctt gcgctgacgc tcagcctcgc cgccactgct        60
     tcgcctgcct gggctgattt ctggtccgac gccggcgcca aattcaaggg cgtgacactg       120
     cacggcgtca ccgaaagcac cccgccatcg aactacatca ggaatgtgct tgctccggaa       180
     ttcgaaaaga agaccggcat caaggtcgac atcgagacga cgtcctggga tcagatgtac       240
     gacaaggcca tcaaggacat ggaagccaag actggtatct atgacatggt ctacatcgag       300
     caggacatca tctactccta tctcgccagg aatttcctcg tcgacatcac caagacgctt       360
     aaagaccagc cggatctgaa ggcgccgacc tacgacgatg cgaacttcac cagctttgcc       420
     gactatttca aggacgcgag cggcgatctc ttcggcgttc cgatggaagc cttcctgaag       480
     gcgtatctct atcgtaagga cctgttcgaa gatccgaaga tcaaggaagc tttcaagaag       540
     gaaaccggca aggacctgaa gccggcgacc acacacgcgg aatacaccga gatcgccgaa       600
     ttcttcacga agtacggcaa ggacaacggt atggagctct ggggcaccac cgctcaggca       660
     cataccggcc atccggcgtc ctggtatgaa ttcttcgagt ccatcgcgcc gaccttcggc       720
     gtctacaatt ggggcatcga cgccaagaac aattatgcgg cgacggtcga acatggcggc       780
     gcaatgaacg gcgacaaggc caaggccgcg ttgaagtact ggctgcacct gcgcgacatc       840
     gctcctccgg aatcgacgca gtcaacctgg acggaaaccg caacgacctt cgccgcgggc       900
     cgcgtcgccc agggcctgat ctacggtgag aacgccgcgt ggatcgcaag cgatccggcg       960
     cagtcgaagg tggtcggcca ggtcggtttc gctctgccgc cgctcgagcc gggcgtattg      1020
     gacgacgcga aagctggaaa gggctatatc ggctactacg atggcggcgc cttcggcgtt      1080
     ccggtcacgt ccaagaacaa ggaagcatca ctgctgttcc tcgaattcat cggccagaac      1140
     gaagtgcagc ccgattgggc gatcgccgca ccgcgcatca ccaacaaggc gacgttcgac      1200
     gatccgaagg tgaaggagat ggacgtcaag ctcggcggct tctacacgat gctgaaggac      1260
     gacggcaagc tcttcgccgg cgctcccccc taccccttcc atgcgcaggt gcgtgaagcg      1320
     accgctccta tcttctacga catcctgacc ggcaagatcg ggcccgatga aggcctcgac      1380
     cagatggcgg ccaaggccga agaagagctc acctcgctcg gctatcgcaa ataa            1434
//

If you have problems or comments...

PBIL Back to PBIL home page