(data stored in ACNUC7421 zone)

EMBL: CP001622.PE287

CP001622.PE287       Location/Qualifiers
FT   CDS_pept        297598..298482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0288"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: xylose isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54599"
FT                   /db_xref="GOA:C6B0I0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I0"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACS54599.1"
FT                   /translation="MRRLGIHSFVWTGGQTQEGLEMALNKTAEHGYRTIEFAYLRPEKF
FT                   NLDRLAKLAQSLDVEIGVTMGLPLDRDVSSEDTSAVSAGKQTLADAVRAVRDIGGNKLG
FT                   GILYSAHTKYNRQPTKKGWDNSVAAIAATAEVARQANVDLVLEVVNRFETNLLNTAAQG
FT                   LKFVAETGSEHVRLHLDTFHMNIEEANPAAAIRLAGDKVGYFHIGESNRGYLGDGVINF
FT                   DLIFDALLDIDYKRDIVFESFSTTVVDEGLSLACAIWRDTWEDNDPLAAHAKRYIELKY
FT                   DEAKRRRATNARP"
     atgcgtcgat tgggtatcca ttcatttgta tggacaggcg gccaaacgca ggaagggctg        60
     gagatggccc tcaacaagac ggccgaacac ggatatcgca ccatcgaatt tgcctatctg       120
     cgccccgaga aattcaatct cgatcgactg gcaaagcttg cgcagtcgct tgacgtggag       180
     attggcgtga cgatgggcct gccgctcgac agggacgtat cgagcgagga tacctcagct       240
     gtgtccgccg gcaagcagac gctggccgac gccgttcggg cggtccgtga catcggcggc       300
     aacaagctgg gcggaattct ctattccgcg cacaccaagt acaatcgcca accgacgaag       360
     aagggctggg acaatagcgt cgccgcgatc gccgcaaccg ccgaagtcgc cagacaagcg       420
     aacgtcgacc tcgtcctgga ggttgtcaac cggttcgaga ccaacctgct gaatacggca       480
     gcgcaggggc tgaagttcgt cgccgagacg ggatcggagc atgtccgtct ccacctcgac       540
     acattccata tgaacatcga ggaagccaat ccggccgcgg cgatccgctt ggccggcgac       600
     aaggtcggct acttccacat cggcgagagc aatcgcggtt acctcggtga cggtgtcatc       660
     aacttcgatc tgatcttcga cgctctgctc gacatcgact acaagcgcga catcgtgttc       720
     gaaagcttct cgacgacggt cgtggacgaa ggcctgtcgc tcgcctgtgc gatctggcgc       780
     gacacctggg aggataatga tccgcttgcg gcgcacgcga agcgctacat cgagctgaaa       840
     tatgacgagg ccaagcgccg ccgcgccaca aacgcgcggc cctga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page