(data stored in ACNUC7421 zone)

EMBL: CP001622.PE288

CP001622.PE288       Location/Qualifiers
FT   CDS_pept        298545..299759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0289"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54600"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS54600.1"
FT                   /translation="MNDTVSIGSSPRRIRQNNIVAALQTIYAHRSLSRADLARKLGMNR
FT                   SSSGEIVAELTEGGFVQESDESGKQRLEHSRAGRPGIMLELVPDAAFFVGIEIGVEHIS
FT                   AAVIDLSADVRACRKMAFDTMSSTVEKAVAEGVELIVSAMEKRMIGRCKGLGISAPAHI
FT                   RPDGIVTLAPIIGWREVSLKEIGRSAFPAAVPIAVENDANAFAIGDSYRHGVSGVTLFL
FT                   LMETGVGGGIMIDGKLFRGGHGLAGEIGHTLVPGSGGQKFEQLIGREVLIRQYREAIGR
FT                   KHVDLQEFLGDVHDRVPAAVNIAETWSRHLAYALLQACRLLDPDRIVLGGSVASLYPMV
FT                   AARVAVHMSEGQSIPFPTPEIVVDDDAEFGSAFGAACMLHQRFLSLESEEFGGEDGAPI
FT                   QSATS"
     atgaacgaca ccgtctccat cggaagttcg ccgcgcagga tccgacagaa caatatcgtc        60
     gccgccttgc agacgatcta tgcccaccga agcctcagcc gggcggatct cgcccggaag       120
     ctcgggatga atcgctcgtc ctcgggagag atcgtcgccg agctgacgga aggcgggttc       180
     gttcaggagt cggacgagag cggcaagcag cgcctggagc attcccgtgc cgggcgtcct       240
     ggtatcatgc tcgaactggt ccccgatgcc gcattcttcg tcgggatcga gattggtgtc       300
     gagcatattt cggccgcagt tatcgatctc tccgccgacg tccgggcatg tcggaaaatg       360
     gcgttcgaca ccatgtcttc gaccgtggag aaggccgtgg ccgagggcgt cgagctgatt       420
     gtcagtgcga tggaaaagag gatgatcgga cgctgcaagg gtctcggcat atcggcgccg       480
     gcccacatcc ggccggacgg aattgtcacc ctcgcaccca tcatcggctg gcgggaggtg       540
     tcgttgaagg agattggccg atccgccttc ccggccgccg tcccgatcgc cgttgaaaac       600
     gacgccaacg cctttgcgat cggcgacagc tatcgtcacg gcgtctcagg cgtgaccctg       660
     ttcctgctga tggaaaccgg cgttggcggc ggtatcatga tcgatggcaa gctgttccgg       720
     ggcggccacg gcctggcggg agaaatcggt cacaccctgg tgccgggaag cggcggtcag       780
     aagtttgagc aactgatcgg tcgcgaagtg ctgatcaggc agtatcgcga ggctattgga       840
     cgtaagcacg tcgatctgca ggaattcctt ggcgacgttc atgaccgtgt cccggccgcg       900
     gtcaatatcg ccgaaacctg gtcgcgccat ctcgcatatg cattgctgca ggcctgtcgg       960
     ctgctcgacc ccgacaggat cgtgctgggt ggctctgtgg catccctcta cccgatggtg      1020
     gccgcccggg tggcggtcca catgtcggag ggccagagta tacctttccc cacgccggag      1080
     atcgtcgtgg acgatgatgc ggagttcggc tccgccttcg gggcggcgtg catgttgcac      1140
     cagcgctttc tgtcattgga gagcgaggag ttcggcggcg aggacggtgc gccgatccag      1200
     tcggcgacga gttga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page