(data stored in ACNUC7421 zone)

EMBL: CP001622.PE289

CP001622.PE289       Location/Qualifiers
FT   CDS_pept        299790..300767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0290"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: fructokinase;
FT                   K00847 fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54601"
FT                   /db_xref="GOA:C6B0I2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I2"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54601.1"
FT                   /translation="MTSVLAPDPLGPTVCVGEILVEIVATTVGDGFLKAQPLVGPFASG
FT                   APAIFISQCGRLGGKAAMVGAVGDDDFGRVNTDRLKRDGVDVSTISIDSDYPTGSAFVR
FT                   YRKDGSRDFVYNIATSAAARFGWSQAVGDLIHRSGHLHVMGSALSVPSARAVIDKAVDI
FT                   VKARGGTLSVDPNIRKELKLNEDTERRFSKLVAAADLLLPSGEELERAAGVEGEAEAIR
FT                   RLFEIGVKEIVLKRGAEGATYFGRQGDRIDASAFVVQEVDPTGAGDCFGGAYLTCRRLG
FT                   MSPQQALTYASAAGARNVTVLGPMEGAGTQQELDAFIASTERRP"
     atgacttcag tactggctcc ggacccgctt ggtcccaccg tttgcgtagg ggagatcctc        60
     gtcgagatcg tcgccacgac ggtcggagac ggttttctca aagcccagcc gctcgtcggt       120
     ccgttcgcga gcggagcgcc ggcgatcttc atctcgcaat gcgggcgcct gggcggcaag       180
     gccgcaatgg tcggcgccgt cggcgatgac gatttcggtc gtgtcaatac cgatcgcctc       240
     aaacgcgacg gcgtcgacgt ttcgacgatc tcgatcgatt cggattaccc cacaggcagc       300
     gcctttgtcc gctaccgcaa ggatggctcc agggatttcg tctataacat cgccacatca       360
     gcagctgcgc gcttcggctg gtctcaagcg gtcggcgatc tcatccatcg gagcggacat       420
     cttcacgtga tgggttccgc tctgtcggtc cccagcgcgc gcgcggtgat cgacaaggcg       480
     gtcgacatcg tcaaggcgcg gggcggaacc ctctcagtgg atccgaacat tcgcaaggaa       540
     ttgaagctga atgaggatac cgagcgccgc ttttccaagc ttgtcgctgc cgccgatctg       600
     cttctgccgt ccggagagga gcttgagcgt gccgccggcg tcgaaggcga ggcagaggcg       660
     atccgccgct tgttcgagat cggcgtcaag gagatcgtgc tgaagcgcgg cgccgaaggc       720
     gcaacctatt tcggcaggca aggagaccgc atcgacgcat cggcatttgt cgttcaagag       780
     gtcgacccca ccggcgccgg cgactgcttt ggtggcgcct atctaacctg ccggcggctc       840
     ggaatgtctc cgcagcaagc tctgacctat gcctcggccg ccggcgcccg caacgtgacg       900
     gtcctcggtc cgatggaagg tgccggcact cagcaagaac tcgatgcatt catcgcttca       960
     accgaaaggc gcccgtga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page