(data stored in ACNUC7421 zone)

EMBL: CP001622.PE29

CP001622.PE29        Location/Qualifiers
FT   CDS_pept        complement(27422..28471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0030"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG:
FT                   rec:RHECIAT_CH0000415 phosphate starvation inducible
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54341"
FT                   /db_xref="GOA:C6AYB7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYB7"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACS54341.1"
FT                   /translation="MNGQELVSSSPRHPRTPSDTNHFVLTFENNRFASELFGQFDQNLK
FT                   LLEQRLNIDARARGNSVVITGDVVTTNQARRTLDYLYEKLQKGGSVEQSDVEGAIRMAV
FT                   AADDQLSLPTMERKAKLTMAQVSTRKKTIIARTPTQDAYIRALERAELVFGVGPAGTGK
FT                   TYLAVAHAAQLLERGAVEKIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDMI
FT                   PADKVDRAITAGVIEIAPLAFMRGRTLANAAIILDEAQNTTSMQMKMFLTRLGENARMI
FT                   VTGDPSQIDLPRGVKSGLVEALQLLNGVEGISIVRFTDTDVVRHPLVGRIVRAYDSTYA
FT                   VAEDVSRQG"
     ttgaacggac aagaattggt ttcttcttca ccgcgccacc cccgcacgcc gagcgatacc        60
     aatcacttcg tcctgacgtt cgagaacaac cgcttcgcca gcgagctctt cggtcaattc       120
     gaccagaacc tcaagctgct cgaacaacgg ctgaacatcg atgcgcgggc acgcggcaat       180
     tcggtcgtca tcacaggcga tgttgtgacc accaaccagg cgcggcgcac gctcgactat       240
     ctctatgaaa aacttcagaa aggcggcagc gtggaacaat ccgacgtcga gggcgcaatc       300
     cgcatggcgg tcgccgccga cgatcagctc agcctgccga ccatggagcg caaagccaag       360
     ctgacgatgg cgcaggtttc cacgcgcaag aagacgatca tcgcccgcac gccgacgcag       420
     gacgcctata tcagggcgct ggaacgcgcc gagctcgtct tcggcgtcgg cccggccggc       480
     actggcaaga cctatcttgc cgtcgcccat gccgcccagc tcctggagcg cggcgcggtc       540
     gaaaagatca tcctgtcgcg cccggccgtc gaggccggcg aacgcctcgg cttcctgccc       600
     ggggacatga aggaaaaggt cgacccctat cttcgcccgc tctatgacgc actctacgac       660
     atgatcccgg ccgacaaggt cgaccgggcg atcactgccg gcgtcatcga aatcgcgccg       720
     ctggccttca tgcgcggccg cacgctcgcc aacgccgcca tcatcctcga cgaagcgcag       780
     aacacgacgt cgatgcagat gaagatgttc ctgacgcgtc tcggcgagaa tgcgcgcatg       840
     atcgtcaccg gcgacccgag ccagatcgac ctgccgcgcg gcgtcaaatc cggcctcgtc       900
     gaggccttgc agcttctgaa cggcgtcgag ggaatctcga tcgtgcgctt cacggatacc       960
     gacgtcgtcc gccacccgct ggtcgggcgc atcgtcaggg cctatgattc cacgtatgcc      1020
     gtcgccgaag acgtcagccg gcagggctaa                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page