(data stored in ACNUC7421 zone)

EMBL: CP001622.PE290

CP001622.PE290       Location/Qualifiers
FT   CDS_pept        300767..302044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0291"
FT                   /product="D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ"
FT                   /note="PFAM: D-tagatose-bisphosphate aldolase class II
FT                   accessory protein AgaZ; KEGG: D-tagatose-bisphosphate
FT                   aldolase, class II, non-catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54602"
FT                   /db_xref="GOA:C6B0I3"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I3"
FT                   /inference="protein motif:PFAM:PF08013"
FT                   /protein_id="ACS54602.1"
FT                   /translation="MQVHLNELAKMRIEGHPRGVTSVCSAHPIVLRAALRHGRQQASTV
FT                   LIEATCNQVNHLGGYTGMTPSDFASLVRKIAVEEGCPENLIVLGGDHLGPNPWRDRPAE
FT                   EAMAEAEKMVAAYVDAGFRKIHLDASMGCKGEPVALDDETTAHRAARLAAVAEASAKKR
FT                   GGAMPVYVIGTEVPPPGGADHALTTIDPTAAAAALKTIEVHRRIFAEAGLGQAFERAIG
FT                   LVVQPGVEFGNQNVILYDRSKIDALKSVLTEEPQFVFEAHSTDYQGTRPLAALVEDGFP
FT                   ILKVGPELTFVLREALYALDAIASHLLPDYGQRPLYAAMEALMLDQPGNWSRHYHGTNA
FT                   EMRWLRHYSLSDRIRYYWASAEAQEAVGRLCEALRGQIVPLPLFWQHMPAAQEFADAPL
FT                   DPEQVLIWRVTKSLSDYHAACGVGKN"
     atgcaggtgc atctcaacga actggccaag atgaggatcg aaggccaccc cagaggcgtg        60
     acctccgtat gctcggccca tcccatcgtg cttcgcgccg cactccgaca cgggcggcaa       120
     caggcaagca ccgtcctgat cgaagcgacc tgcaaccagg tcaatcacct cggcggctat       180
     accggaatga cgccaagcga cttcgcgtcc ctcgtccgca aaatagcagt cgaggaaggg       240
     tgcccggaaa atctgatcgt tctcggcggc gatcatctcg gccccaatcc ttggcgtgac       300
     cggccggccg aagaggccat ggccgaggcg gagaagatgg ttgccgccta tgtcgatgcc       360
     gggtttcgca agattcacct cgatgcctca atgggctgca agggcgagcc ggtggcgctc       420
     gacgacgaaa ccaccgccca tcgcgccgcc cggcttgcgg cggtcgccga ggcctcggcg       480
     aagaagagag gcggcgcaat gccggtttat gtcatcggca ccgaagtgcc gccgccaggc       540
     ggggccgatc atgccctgac aaccatcgat ccgacggcgg ccgcagcggc gctgaagacg       600
     atcgaagtcc accgccggat ctttgcagag gcaggactcg gccaagcgtt tgaacgggcc       660
     atcgggctgg tcgttcagcc gggcgtcgag ttcggcaatc agaatgtcat cctttacgac       720
     cgcagcaaga tagacgcgct gaaatcggtg ctcaccgagg agccgcagtt tgtcttcgag       780
     gcgcattcga cggattatca gggaacccgg cccttggccg cgctggtgga ggatggcttt       840
     cccattctga aggtcggtcc cgaactgacc ttcgtcctgc gcgaggcgct ctacgcgctg       900
     gatgcgatcg cgtcgcacct tttgcccgat tacggccagc gtccgctcta tgcggcgatg       960
     gaagcgctga tgctcgatca gcccggcaac tggagccgcc actaccacgg gacaaacgcc      1020
     gagatgcgct ggctgcggca ttactcgctg tctgaccgca ttcgctatta ttgggcgtcg      1080
     gctgaagccc aagaggccgt cgggcgcctg tgcgaggcgc ttcgagggca aattgtaccg      1140
     ctgcccttgt tttggcagca tatgccggcc gcacaggaat tcgcagatgc gccgctcgat      1200
     ccggaacagg ttttgatctg gagggtgacg aagagtctct cggactatca cgccgcctgc      1260
     ggcgtcggga agaattga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page