(data stored in ACNUC7421 zone)

EMBL: CP001622.PE291

CP001622.PE291       Location/Qualifiers
FT   CDS_pept        302075..302800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0292"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ribitol 2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54603"
FT                   /db_xref="GOA:C6B0I4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54603.1"
FT                   /translation="MTELNGKIAAVTGAASGIGLASTEAMLAAGATVVLVDRDEKALET
FT                   VCARLGERAIPLKINLLDPGECAGLLDGILSKTGKLDILHANAGTYIGGDLMETDLDTI
FT                   DRMLNLNVNVVIKNVRSVIPHMIERGTGDIVVTSSVAGHSAIPWEPVYSSSKWAMTCFV
FT                   QTMRRQLLKSGIRVGSVSPGPVISALLADWPEENLRKAKEAGALIEPKEVADAIIFMLT
FT                   RPRNVTIRDIVVLPSAFDI"
     atgacggaat tgaatgggaa gatcgcggcg gtcacgggtg ctgcgtccgg aattggactc        60
     gcttcgacgg aggcaatgct cgccgctggc gcgacggtcg tgctggtgga ccgcgatgag       120
     aaggcccttg agacggtttg tgcccggctt ggcgagcgcg ctattccgct caagatcaac       180
     ttgctggatc cgggcgagtg tgcgggactg ctcgatggca tcctgtcgaa gaccggcaag       240
     ctcgatatcc tgcatgccaa tgcaggcacc tatatcggcg gcgacctgat ggaaaccgac       300
     ctcgatacca tcgatcggat gctcaatctc aatgtaaacg tcgtcatcaa gaacgttcga       360
     agcgtcattc cgcacatgat cgaacgcggc accggcgaca ttgtcgtcac cagctccgtc       420
     gctggacact cggcgattcc atgggaacct gtttattcgt catcgaagtg ggcgatgacg       480
     tgcttcgtcc agacgatgcg acgccagctt ctgaaaagtg gcattcgtgt ggggtcggtt       540
     tctccagggc cggtgatcag cgctttgctt gcggactggc cggaggaaaa ccttcgcaag       600
     gccaaggagg ccggagcctt gatcgagccc aaggaagtcg ccgacgcgat catcttcatg       660
     ctgacccgtc cgcgcaacgt cactatccgc gatatcgtcg tgcttccaag cgcctttgac       720
     atttga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page