(data stored in ACNUC7421 zone)

EMBL: CP001622.PE292

CP001622.PE292       Location/Qualifiers
FT   CDS_pept        302812..303585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0293"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: sme:SMc02339 putative oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54604"
FT                   /db_xref="GOA:C6B0I5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS54604.1"
FT                   /translation="MSYQQKFRLDGERAVVTGGGRAIGLCCTEALAEAGAAVVVIERSE
FT                   ADAVQALALRDRGYDVEVRVGDVTDAARMDAIAAELADGGRPATILVNNAGIGQSGIPA
FT                   QDLTDADWLRMMDVNLNGVFWCSRAFGRPMISMKRGAIVNLGSMSGTICNRPQPQTAYN
FT                   VSKAAVHHLTRSLAAEWAHHGIRVNAVAPTYIETPMVVAVEANRERIPLWLADTPMGRM
FT                   GTPEEVASAVLFLASGAASLMTGAIVNVDAGFTCW"
     atgagctacc agcagaaatt tcgcctcgac ggcgaacggg cggtggtcac aggcggaggg        60
     cgtgcgatcg gtctctgctg caccgaggcg ctggcggagg cgggcgccgc cgtcgtcgtc       120
     atcgaacgca gcgaggccga cgctgtgcaa gcacttgcgt tgcgcgacag aggctacgac       180
     gtcgaagtcc gggtcggcga cgtcacagac gcggcccgaa tggacgcgat cgcggctgaa       240
     ctcgccgacg gcgggcggcc ggcgaccatc ctggtgaaca atgccggaat tggccagagc       300
     ggcatcccgg cgcaggatct caccgacgcc gattggctgc gcatgatgga cgtcaatctc       360
     aacggcgtct tctggtgctc gcgcgccttt ggtcgtccga tgatttcgat gaaacgcggc       420
     gccatcgtca acctcggctc gatgtcgggg acgatctgca accggcccca gcctcagacg       480
     gcctataacg tctccaaggc ggcagtccat cacctcacgc gctcgttggc cgccgagtgg       540
     gcacaccacg gtatcagggt aaatgccgtt gcgcccacct atatcgagac accgatggtg       600
     gtggccgtcg aagccaatcg cgagcgtatt ccgctctggc tcgccgacac gccgatgggc       660
     aggatgggaa cgccggaaga ggttgccagc gcggtcctct tcctcgcctc gggcgcggcc       720
     agcctgatga ccggggcgat cgtcaacgtc gatgcgggat tcacctgctg gtag             774
//

If you have problems or comments...

PBIL Back to PBIL home page