(data stored in ACNUC7421 zone)

EMBL: CP001622.PE293

CP001622.PE293       Location/Qualifiers
FT   CDS_pept        303723..304547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0294"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   aldolase protein; K01623 fructose-bisphosphate aldolase,
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54605"
FT                   /db_xref="GOA:C6B0I6"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6B0I6"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ACS54605.1"
FT                   /translation="MKSARLNRLFGVSGNCFDVAIDHGMFNERTFLAGIENMKTAIEVI
FT                   AQAAPGAIQLPPGTAPMLQAIPGKQRPALVLRTDIANIYGNPLPSQLFSEMIDRAVEQG
FT                   VALDAACVVVNLLMLPDQPEVYRACVRNVNSLKRECEIYGMPLMVEPLVMQDNSKGAYM
FT                   VDGAIDKILPLVRQAAELGADIIKADPCDNVEEYHRVVEIAQGLPVLVRGGGRVSDQEI
FT                   LIRTKQLMEQGARGIVYGRNVIQHQNPAGMTRALMAIVHDKASVEQALLHIG"
     atgaaatccg cgcgattgaa ccgacttttc ggcgtgtctg gaaattgttt tgacgttgct        60
     atcgatcacg gcatgttcaa tgaacggact ttcctcgccg gcatcgagaa catgaagact       120
     gcgatcgagg tgatcgcgca agcggcgccg ggtgcaattc agctgccgcc gggaaccgca       180
     cccatgctgc aggcgatccc cggcaagcag cgtccggcgc tggtgctgcg caccgacatc       240
     gccaacatct atggcaatcc cctgccgtct cagctgtttt ccgaaatgat cgacagggcg       300
     gtggaacagg gcgttgcgtt ggatgccgcc tgtgtcgtcg tcaatctctt gatgctgccg       360
     gaccagccgg aagtctaccg cgcctgcgtg cgcaatgtga acagcctgaa acgcgaatgc       420
     gagatctacg gcatgccgct gatggtcgag ccgctcgtca tgcaggacaa ttccaagggc       480
     gcctacatgg tcgacggcgc gatcgacaag atcctgccgc tcgtgcgcca ggcggccgaa       540
     ctcggcgctg atatcatcaa ggccgacccc tgcgacaatg tcgaggaata tcaccgcgtc       600
     gtcgagatcg cccaaggcct gccggtgctg gtgcgcggcg gcggccgcgt ttcggatcag       660
     gaaatcctga tccgcaccaa gcagttgatg gagcagggcg cccgtggcat cgtctatggc       720
     cgcaacgtca tccagcatca aaatcccgcc ggcatgacgc gggccttgat ggcgatcgtc       780
     catgacaagg cttccgtcga gcaggccttg ctgcatattg gctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page